KEGG   Aeromonas hydrophila pc104A: V429_20825
Entry
V429_20825        CDS       T03193                                 

Definition
(GenBank) DNA topoisomerase IV subunit A
  KO
K02621  topoisomerase IV subunit A [EC:5.6.2.2]
Organism
ahp  Aeromonas hydrophila pc104A
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_20825
   03036 Chromosome and associated proteins [BR:ahp03036]
    V429_20825
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ahp02048]
    V429_20825
Enzymes [BR:ahp01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     V429_20825
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Topoisomerases
   V429_20825
Chromosome and associated proteins [BR:ahp03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    V429_20825
Prokaryotic defense system [BR:ahp02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    V429_20825
SSDB
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C
Other DBs
NCBI-ProteinID: AHX71168
LinkDB
Position
complement(4498028..4500322)
AA seq 764 aa
MSDAIELSLDGVERQPMRTFTEQAYLNYSMYVIMDRALPHIGDGLKPVQRRIIYAMSELG
LSALSKHKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPK
SFAAMRYTEARLSRFSELLLSELGQGTVEWTPNFDGTMKEPVVLPARLPHILLNGVTGIA
VGMATDIPPHNAREVAHACVELLDNPNAGLDALMAHVQGPDYPTNAEIITPRDDIRKIYE
TGKGSIKQRAVWSEEDGDIVITALPHQASGAKIMEQIAAQMVAKKLPMVTDLRDESDHEN
PTRLVIVPRSNRVDVEGLMAHLFATTDLEKNYRVNLNILGLDNRPQVKDLKTILTEWLSF
RRETVRRRLQYRLDKVLARLHILEGLLIAYLNIDEVIEIIRTEEEPGRVMMERFNISETQ
AEAILELKLRHLAKLEEFKLRAEQHELAEERDKLELILGSERRLSTLLKKEILADAEKYG
DDRRTPLVERATAVALTEKELTPSEPVTVILSDKGWVRAAKGHDVDVEGLSYKAGDGYLA
HAHGRSNQQAVFLSTLGRTYSLEAHTLPSARSQGEPLTGRFALGAGEEVRHLVMGNEGEP
YLICSDAGYGFVCKYDDLIGKNKNGKALLTVPEGGLVMAPQKIGAPETDLCMAISNEGRM
LLFPLSTLPVLGKGKGNKLISIPSARVKAREEFVVMAAVIPQGQSVTLFAGKRKLTLKPS
DLDYYRGERGRRGAKLPRGLQRVDRIEIETVAGAEPVAGENQEG
NT seq 2295 nt   +upstreamnt  +downstreamnt
atgagtgatgctatcgagctcagtctggacggggtagagcgccagccaatgcgcaccttt
accgaacaggcttacttgaactactccatgtacgtcatcatggatcgggccctgccgcat
atcggcgacggcctcaagcccgtgcagcggcgcatcatctacgccatgagcgagctgggt
ctgtcggcgctgtccaagcacaagaagtcagcccgtaccgtgggtgacgtgctgggtaag
taccacccccatggcgacagcgcctgttatgaagccatggtgctgatggcccagcccttc
tcctaccgctacccgctggtggatggtcagggcaactggggggcgccggacgatcccaaa
tccttcgccgccatgcgttataccgaggcgcgcttgtcgcgcttctccgagctgctgctc
tccgagctcggccagggcacggtggagtggacgccaaacttcgacggcacgatgaaggag
cccgtggtgctgcccgcccgcctgccgcacatcctgctcaacggggtgaccggcatcgcg
gtggggatggcgaccgatatcccgccccacaacgcgcgggaagtggcccacgcctgtgtg
gagcttttggataaccccaatgccggcctggatgccctgatggcccatgtgcaggggccg
gactacccgaccaacgccgagatcatcacgccgcgcgacgacatccgcaaaatctacgag
accggcaagggctccatcaagcagcgggcggtgtggagcgaggaagatggcgacatcgtc
atcacggcgctgccccatcaggcctccggcgccaagatcatggagcagattgccgcccag
atggtggccaaaaagctgcccatggtcaccgatctgcgcgatgagtcggaccacgaaaac
ccgacccgtctggtgatcgtgccgcgctccaaccgggtggacgtggaggggctgatggcc
cacctgttcgccaccacggacttggagaagaactaccgggtcaacctcaacatcctgggt
ctggacaaccggccccaggtgaaagacctcaagaccatcctcaccgagtggctgagtttc
cgccgcgagacggtgcgccgccgcctgcaatatcgtctcgacaaggtgctggcccgcctg
cacatcctcgaaggtttgctcattgcctacctcaacatcgacgaggtgatcgagatcatc
cgcaccgaggaagagccgggccgggtgatgatggagcgcttcaacatcagcgagacccag
gccgaggcgatcctcgagctcaaactgcgccacctggccaagctcgaagagttcaagctg
cgcgccgaacagcacgaactggccgaagagcgcgacaagctggaactgatcctgggttcc
gagcgccgtctcagcaccctgctgaagaaagagatcctggcagatgccgagaagtacggt
gacgatcgccgcactccgctggtggaacgtgccaccgccgtggccctgaccgagaaggag
ctcaccccgagcgagccggtcaccgtgatcctctctgacaagggctgggtgcgtgccgcc
aagggccacgacgtggatgtggagggcctctcctacaaggcgggggacggctatctggcc
cacgcccatggccgcagcaatcagcaggcggtgttcctctccaccctggggagaacctac
tcgctggaggcccacaccctgccctccgcccgcagtcagggcgagccgctcaccggtcgc
ttcgcgctgggggctggcgaagaggtacgccatctggtgatgggcaacgagggcgagccg
tatctgatctgttccgacgccggttacggcttcgtctgcaaatatgacgacctgattggc
aagaacaagaacggcaaggcgctgctgaccgtgccggaagggggcctggtgatggcaccc
cagaagataggcgcgccggagaccgatctctgcatggccatctccaacgagggccgcatg
ctgttgttcccgctgagtacattgccggtgctcggcaagggcaagggcaacaagctcatc
agcatcccctcggcgcgcgtcaaggcgcgggaggagtttgtggtgatggccgccgtcatt
ccgcaggggcagtcggtcaccctgtttgccggcaagcgcaagctcaccctcaagccctct
gatcttgactactaccgcggcgagcgcggccgccgtggcgccaaactgccccgtggcttg
cagcgcgtcgatcgcatcgagattgaaactgtcgccggcgccgagccggtagccggggaa
aatcaggaagggtaa

DBGET integrated database retrieval system