KEGG   Aeromonas hydrophila pc104A: V429_20855
Entry
V429_20855        CDS       T03193                                 

Definition
(GenBank) DNA mismatch repair protein MutT
Organism
ahp  Aeromonas hydrophila pc104A
SSDB
Motif
Pfam: NUDIX Nudix_N DUF3237
Other DBs
NCBI-ProteinID: AHX71174
LinkDB
Position
complement(4506049..4506672)
AA seq 207 aa
MQPPLATFLEQVLATAQAGLTYSKDPFDIGRFEALRAATVALIASQSELAPEAISDWIAL
DSGYPTPKLDVRAFIQNDAGHILLVQERSDGCWTLPGGWCDIGDSPAGAVVREVVEETGL
ECRAVQLLALFDKLKHPHPPQLPHAHKAFFLCEVTGGQLLGETDETKGAGYFPIDDLPPL
SRHRVVASQLRTLYDHLLQGRKDTLFD
NT seq 624 nt   +upstreamnt  +downstreamnt
atgcagccgccgttggccacctttctggaacaggtgctggccacggcgcaagcgggcctc
acctactccaaagatcccttcgacatcggccgtttcgaggcgctgcgagcggccacggtg
gcgctcatcgccagccagagcgagctggcaccggaagccatcagcgactggatcgccctc
gacagcggttatcccacccccaagctggatgtgcgggccttcattcagaacgatgcgggc
catatcctgctggtgcaggagcgcagcgacggctgctggactctgccggggggctggtgc
gacatcggtgactcgccggcgggggccgtggtgcgcgaagtggtggaggagaccggcctt
gagtgccgggcagtgcagctgctggcgttgttcgacaagctaaaacaccctcatccgccc
cagctgccccacgctcacaaggcgttcttcctgtgcgaggtgaccgggggccagctgctg
ggcgaaaccgatgaaaccaaaggggcggggtacttccccatcgacgacttgcccccgctc
tcccgccatcgggtggtggcctcccagctgcgcaccctgtatgaccatcttttacaaggg
cggaaggataccctgttcgattga

DBGET integrated database retrieval system