KEGG   Aeromonas hydrophila pc104A: V429_20950
Entry
V429_20950        CDS       T03193                                 

Definition
(GenBank) LrgB
Organism
ahp  Aeromonas hydrophila pc104A
SSDB
Motif
Pfam: LrgB
Other DBs
NCBI-ProteinID: AHX71193
LinkDB
Position
4522778..4523467
AA seq 229 aa
MSDTLLGLLCFALTLLFYYANKWLYGKKRILPLMPLLLAPTLLVAVVMLFHIPYQDYMAE
SHWLLWLLGPATVAFAVPVYENRQLIRRHWLSLSVGVVASVVMAVGSTVLLARWLDLSDM
LQRSLAMRSITTPFAVEATRAIGGQTDLTALFVVLTGVIGMAVGESVLTLLAIRSRLGKG
AGFGASAHGAGTAKAYQMGNEEGVVSSMVMMIAGMVTVLLAPLLGQLFW
NT seq 690 nt   +upstreamnt  +downstreamnt
atgtctgataccttgctcggtctgctctgcttcgccctcaccctgctgttctactacgcc
aacaagtggctctacggcaagaagcgcatcctgcccttgatgccgctgctgctggccccc
accctgctggtggcggtggtgatgctgttccacatcccctatcaggactacatggccgaa
tcccactggctgctgtggctgctggggccggccaccgtcgccttcgcggtgccggtctac
gaaaaccgccagctcattcgccgccactggctgtcgctgtcggtaggggtcgtcgcctcg
gtggtgatggccgtgggcagtaccgtgctgctggcccgctggctcgatctctccgacatg
ctgcagcgcagtctggcgatgcgctccatcaccaccccgtttgcggtggaggcgacccgc
gccatcggcggccagaccgatctcaccgccctgttcgtggtgctcaccggcgtcatcggc
atggcggtcggcgagagcgtgctcaccctgctggccattcgcagccgactcggcaaaggt
gcggggtttggtgcctcggcccacggcgccggcactgccaaggcttatcagatgggcaat
gaggagggggtggtctccagcatggtgatgatgatcgccggcatggtgaccgtgctgctg
gcgcccctgctcggccagctgttctggtaa

DBGET integrated database retrieval system