KEGG   Aeromonas hydrophila pc104A: V429_20985
Entry
V429_20985        CDS       T03193                                 

Definition
(GenBank) adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    V429_20985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_20985
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     V429_20985
DNA repair and recombination proteins [BR:ahp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     V429_20985
 Prokaryotic type
     V429_20985
SSDB
Motif
Pfam: NUDIX_4 HhH-GPD HHH EndIII_4Fe-2S Whib HHH_5 HHH_8
Other DBs
NCBI-ProteinID: AHX71200
LinkDB
Position
4529543..4530604
AA seq 353 aa
MNNSDNATFATRILDWYQLHGRKTLPWQQEKTPYRVWVSEIMLQQTQVATVIPYYQRFMA
RFPDVLALADAPIDEVLHHWTGLGYYARARNLHKAAQQIRDLHGGLFPERLEEVMALPGI
GRSTAGAVLSLSLGQPHAILDGNVKRVLTRWLALPGWPGQKQVENDLWELATRLTPKLGV
AHYNQAMMDMGATVCTRSKPACERCPVREDCQGLSQGNPTAYPNSKPKKSIPARTGIMLL
IRHGDQLLLEKRPPQGIWGGLYCFPQVESDAEVAGLLQRLGLTGNKPRELAGFRHTFSHF
HLDIRPMLIETDTPPAPLLMEADNRLWYNLRHPAEVGLAAATARLLAYPDLQP
NT seq 1062 nt   +upstreamnt  +downstreamnt
gtgaacaactcagataacgcgaccttcgccaccaggatcctggactggtatcagctccac
ggccgcaagaccctgccctggcaacaggagaagaccccctaccgggtttgggtctcggaa
atcatgctgcagcagacccaggtcgctacggttattccctactatcagcgcttcatggcc
cgctttcccgacgtgctggcactggccgacgcccccatcgacgaggtgctgcaccactgg
accgggctcggctattacgcccgcgcccgcaacctgcacaaggcggcccagcagatccgc
gacctccatggtggactcttcccggagcggctggaggaggtgatggcgctgccggggatc
ggccgctccaccgcgggcgccgtgctctccctctcccttggccagccccacgccattctg
gatggcaacgtgaagcgggtacttacccgctggctggccctgcccggttggcccggccag
aagcaggtggagaacgatctgtgggagctggccacccgcctcacccccaagctcggggtg
gcccactacaaccaggccatgatggacatgggcgccaccgtctgcacccgcagcaagccc
gcttgcgagcgctgcccggtgcgggaggattgccaggggctgtcgcagggcaaccccacc
gcctaccccaacagcaagcccaagaagagcatcccggcccgtaccggcatcatgctgctc
atccgccacggcgatcagctgctgctggagaaacggccgccgcaagggatctggggcggg
ctctactgcttcccccaggtggagtcggacgccgaggtagcggggctgctgcagcggctc
ggtctgaccggcaacaagccccgtgaactggccggttttcgccatactttcagccacttt
cacctcgatatccggcccatgctgatcgaaaccgacacgccgccggcccccctgctcatg
gaagcggataaccgactctggtataacttacgccatcctgcagaggtgggtctggcggcc
gccacggcccgtctgctcgcctatccggacttacaaccatag

DBGET integrated database retrieval system