KEGG   Aeromonas hydrophila pc104A: V429_21000
Entry
V429_21000        CDS       T03193                                 

Definition
(GenBank) DNA-binding protein
Organism
ahp  Aeromonas hydrophila pc104A
SSDB
Motif
Pfam: BOF tRNA_anti-codon Cupin_2
Other DBs
NCBI-ProteinID: AHX71203
LinkDB
Position
complement(4532148..4532528)
AA seq 126 aa
MNKASVIGLLTLMSISSFAMAAYTGPQEQNKVSVAQLKDLADDSWATLEGKLVKHLGGEN
YMFRDASGEVEVEVDQDVWRGTEVGPDDLIRIRGEVDHSWNKTEVEVESLEKVGAAPQSK
GGFIAK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaacaaggcaagcgtaatcggtctgttgaccctgatgtccatctcttctttcgccatg
gcggcctataccggcccgcaggagcagaacaaggtgtccgtcgcgcagttgaaggatctg
gccgatgacagctgggccaccctggaagggaagctggtcaagcacctgggcggcgagaac
tacatgttccgcgacgccagtggcgaggtggaagtggaagtggatcaggatgtgtggcgt
ggcaccgaggttggcccggacgatctgatccgcatccgtggcgaggtggaccacagctgg
aacaagaccgaagtagaggtggagagcctggagaaggtgggcgccgccccgcagagcaag
ggcggtttcatcgccaagtaa

DBGET integrated database retrieval system