KEGG   Aeromonas hydrophila pc104A: V429_21130
Entry
V429_21130        CDS       T03193                                 

Definition
(GenBank) spermidine/putrescine ABC transporter permease
  KO
K02054  putative spermidine/putrescine transport system permease protein
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    V429_21130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ahp02000]
    V429_21130
Transporters [BR:ahp02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter
    V429_21130
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: AHX71224
LinkDB
Position
4555133..4556101
AA seq 322 aa
MSAPHSASLAMSQPTAPLSYRPLRRLSTLLYGRPGLLLAILLGPPLLWLGIIYVGSLLML
LSNAFFGLDEFSGQIRHELGLQNFVALLRAENLDVILRTVGMSLLVTLACALLGFPVAYY
MARYTSGKTRALFYVGIMLPLWSSYLVRVYAWKLILAKEGVISWLADSLGLDWLLDAILS
LPVIGGPSLSFSRIGTFIVFVYVWLPFMILPIQAAVERIPRSLLEASGDLGATPAQTFRT
LILPLALPGVVAGSIFTFSLTLGDYIIPGIIGNSTMYIGQVVYMQQGTAGNLPFAAAFSL
VPILIIAIYLTIAKRLGAFDAL
NT seq 969 nt   +upstreamnt  +downstreamnt
atgagcgccccccacagtgcgagccttgccatgagccaacccactgcccccctctcctat
cggccgctgcggcgcctctccaccctgctctacgggcggccgggtctgttgctggccatc
ctgctcgggccgcccctgctgtggcttggcatcatctatgtcggctccctgctgatgctg
ctctccaacgccttcttcgggctggacgagttcagcggccagatccgccacgagctgggg
ctgcagaacttcgtcgccctgctgcgagcggagaacctggacgtgatcctgcgcaccgtc
ggcatgtcgctgctggtgaccctagcctgcgccctgctcggctttccggtggcctactac
atggcgcgctacaccagcggcaagacccgggccctgttctacgtcggcatcatgctgccg
ctctggtccagctatctggtgcgggtctacgcctggaagctgatcctggccaaggagggg
gttatcagctggctggcagacagccttgggctggactggctgctcgatgccatcctctcg
ctgccggtgatcggggggccgtcgctgtcgttctcgcgcatcggcaccttcatcgtattc
gtctacgtctggctgcccttcatgatcctgcccatccaggcggcggtggagcggatcccg
cgctccctgctggaggcgagcggcgatctcggcgccaccccggcccagacctttcgcact
ctgatcctgccgctggccctgcccggggtggtggcgggctccatcttcaccttctccctg
acgctgggggactacatcatccccggcatcataggcaactccaccatgtacataggtcag
gtggtctacatgcagcagggcacggcgggcaacctgcccttcgccgccgccttctcgctg
gtgccgatcctcatcatcgccatctacctcaccatcgcgaaacgcttgggggctttcgat
gcgctctaa

DBGET integrated database retrieval system