KEGG   Aeromonas hydrophila pc104A: V429_21155
Entry
V429_21155        CDS       T03193                                 

Definition
(GenBank) AsnC family transcriptional regulator
  KO
K03719  Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein
Organism
ahp  Aeromonas hydrophila pc104A
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ahp03000]
    V429_21155
   03036 Chromosome and associated proteins [BR:ahp03036]
    V429_21155
Transcription factors [BR:ahp03000]
 Prokaryotic type
  Helix-turn-helix
   Lrp/AsnC family
    V429_21155
Chromosome and associated proteins [BR:ahp03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    V429_21155
SSDB
Motif
Pfam: AsnC_trans_reg HTH_AsnC-type HTH_24 HTH_20 MarR_2 MarR HTH_IclR Rrf2 HxlR TrmB HTH_28 HTH_Crp_2
Other DBs
NCBI-ProteinID: AHX71229
LinkDB
Position
4560179..4560637
AA seq 152 aa
MTDKFDLLILAELQQDARLPIPELAHRVGLSAPACYRRVRALREAELIEREVALVAPATM
GWPITMLVLVTLERDHGRIVDEMIASLQGEPEVMDLWYVTGEQDFVLQVAARDMQSYDLF
TRRVLHAREQVRSFKTLVVMKQHKRCGALLPA
NT seq 459 nt   +upstreamnt  +downstreamnt
atgaccgacaaattcgatctgctcatcctcgccgaactacagcaggatgcccgcctgccg
atccccgagctggcccaccgggtcggcctctcggcaccggcctgttaccgccgcgtacgg
gcgctgcgggaggcggaactcatcgaacgggaagtggcactggtagcaccggccaccatg
ggttggcccatcaccatgctggtgctcgtgacgctggagcgggatcacggccgcatcgtc
gatgagatgatcgccagcctgcaaggggagccggaggtcatggacctctggtacgtcacg
ggggagcaggacttcgtgctgcaggtcgccgcacgggacatgcagagctacgacctgttt
acccggcgggtgctgcatgccagggagcaggtgcgcagcttcaagactctggtggtcatg
aaacagcacaaacgctgcggagccttgttgcctgcctga

DBGET integrated database retrieval system