KEGG   Aeromonas hydrophila pc104A: V429_21295
Entry
V429_21295        CDS       T03193                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp00790  Folate biosynthesis
ahp01100  Metabolic pathways
Module
ahp_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    V429_21295
Enzymes [BR:ahp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     V429_21295
SSDB
Motif
Pfam: HPPK
Other DBs
NCBI-ProteinID: AHX71253
LinkDB
Position
4584450..4584959
AA seq 169 aa
MTRIYISLGSNIERERHIRAGLDALQAEFGELQVSRVFESEAVGFNGRPFYNLVVGADTE
LPLATLCQRLRAMEFAHGREPDAKKFAPRTLDLDLLLYGDLVCETPLVLPRGELLSNAFV
LWPLAELAPTLRHPLDGRTLGELWERYDKASQRLCPIPFHWAAGELQHH
NT seq 510 nt   +upstreamnt  +downstreamnt
atgacccgtatctatatcagcctgggatccaatatcgagcgggagcgtcatatccgcgcc
ggcctcgatgcgctgcaggccgagtttggcgagctgcaggtctcccgggtattcgagagc
gaggcggtgggcttcaacggccgccccttctacaatctggtggtgggcgccgataccgag
ctgccgctggcgaccctgtgccagcgactgcgcgccatggagttcgcccacggccgcgag
ccggacgccaagaagttcgccccgcgcaccctagatctcgatctgctgctctatggcgac
ctggtctgcgagacgccgctggtgctgccgcgcggcgagctcctcagcaacgccttcgtg
ctctggccgctggccgaactggcacccaccctgcgccatccgctggatggccgcactctt
ggtgagctgtgggagcgttacgacaaggcctcccaacggctctgccccatcccctttcac
tgggcagcgggcgaattgcagcaccactga

DBGET integrated database retrieval system