KEGG   Aeromonas hydrophila pc104A: V429_21945
Entry
V429_21945        CDS       T03193                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    V429_21945
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_21945
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     V429_21945
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     V429_21945
SSDB
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD AAA_11 Viral_helicase1 SH3_13 AAA_22 UvrD-helicase AAA_16 AAA_28 UvrD_C CbiA T2SSE SRP54 NTPase_1 AAA_24 DUF2075
Other DBs
NCBI-ProteinID: AHX71371
LinkDB
Position
complement(4722316..4724355)
AA seq 679 aa
MNGTMMIERLKALALAGRIRQLDLQFARLVADLGGSPELVLGAALACFELGRGHVCLPLE
MIIAGSLRPFGLDPEQSRDLLADLVDPARWLALFAESPLVGTEQDDGLAPRWPLRLWHGR
LYLTRYHDFEHGVARHLRALGERAEWPEIAPALSRLFARDYGLVFGALLKARLAPDFSAR
HFIEKYLDLVFPSEVDWPAIEALLASAQAASDLSVLDALVPEALCCNGQKLAAATAAARP
FAVISGGPGTGKTTTVAKLLAILVETGLQAGKAPAIRLVAPTGKAAARLTESIGSALQAL
DLPPEWVEAIPTEAGTLHRLLGVIPGRSQFRHHAGNPLHLDLLVVDEASMVDLPMMARLL
DALPSHARLILLGDKDQLASVEAGAVLGDICSFIEQGISPAQADWLSRQTGYRLQGSPAG
TPVRDSLCLLAKSWRFDQHSGIGQLARACNSGDATAVEAVWGAGFADISLHPWAGDAYDA
LIAQGVAGYGAYLKAARAGEDPAAVFKAFNSFQILCALRDGPFGVEGLNERLELALSRAS
LIARDGDWYAGRPVMVVRNDHGVGLYNGDMGLCLPDESGRLKVWFEQPDGTLRALLPSRL
PPHETVYAMTIHKSQGSEFAHTVLVLPDSPSPLLTRELVYTGITRAKARLDLYGDRALLA
QAVRKKTERYSGLAERLGE
NT seq 2040 nt   +upstreamnt  +downstreamnt
atgaacggcaccatgatgattgaacgactcaaggccctggcgctggcgggccgcatccgc
cagctggatctgcaatttgccaggctggtggccgatctgggcggcagccccgagctggtg
ctgggggcggcgctcgcctgcttcgagctggggcgcggccatgtttgtctgccgcttgaa
atgatcatcgccggatctttgcgcccgttcgggctggatccggagcagagccgggatctg
ctggccgatctggtggatcctgcccgctggctcgccctgtttgcagagagtccgctggtt
ggcactgagcaggatgacgggctcgccccgcgctggccgctgcggctgtggcacgggcgg
ctctacctcacccgctaccacgactttgagcatggggtggcccgccatctgcgcgccttg
ggtgaacgcgccgaatggccggagatagccccggccctgtcgcggctgtttgcccgcgac
tatggcctggtgttcggggcgctgctcaaggcccgcctcgcccccgacttttcggcccgc
cactttatcgagaaatatctggatctggtgttcccgagcgaggtggattggcccgccatc
gaggcactgctggccagcgcccaggcggcgagtgacctgagtgtgctggatgcgctggtg
cccgaggcgctctgctgcaacggccagaagctggcggcggccaccgcggcggcgcgcccc
tttgcggtgatctccggcggccccggcaccggcaagaccaccacggtcgccaagctgctc
gccattctagtggagaccggcctgcaagcgggcaaggccccggcgatccggctggtggcc
cccaccggcaaggcggcggcgcgcctcaccgagagtatcggctctgccctgcaggccctg
gatctgccccccgaatgggtcgaggcgatccccaccgaggcaggcaccttgcaccggctg
ctcggggtcattccggggcgcagccagttccgccaccatgcgggcaacccgctgcatctg
gacctgctggtggtggatgaggcctccatggtcgacttgccgatgatggcgcgcctgctc
gatgcgctgccgagccacgcccgcctgatcctgcttggcgacaaggatcagctcgcctcg
gtggaggcgggggccgtgctcggcgatatctgcagctttatcgagcagggcatcagcccg
gcgcaggcggactggctatcccgccagaccggctaccgcttgcagggctcgcccgctggg
actccggtgcgcgacagcctctgtttgctggccaagagttggcgctttgatcagcattcg
ggcatcggccagctggcgcgcgcctgcaacagtggcgatgccacggcggtggaagctgtc
tggggcgcaggattcgccgatatcagcctgcacccctgggccggggatgcctacgatgcc
ctgattgctcagggggtggccggttatggtgcctatctgaaggcggcccgcgcgggggaa
gatcccgccgccgtgttcaaggcattcaacagcttccagatcctctgcgccctgcgcgat
ggcccgtttggggttgaggggcttaacgagcggcttgaactggccctgtcacgggccagc
ctgattgcccgcgatggcgactggtatgccggtcgcccggtaatggtggtgcgcaacgac
cacggggtcggcctctacaacggcgatatggggctctgcctgccagatgaaagcgggcgg
ctcaaggtgtggtttgagcagccggacggcaccctgcgggcgctgttgcccagccgcttg
ccgccccacgagacggtttacgccatgactatccacaaatcccagggctcggagtttgcc
cataccgtgctggtgttgcccgacagccccagcccgctgctgacccgtgagctggtctat
accggcatcacccgcgccaaggcccgcctcgatctctacggcgatcgcgccctgctggcc
caagcggtgcggaaaaagaccgagcgttattccggattggcggagaggttgggggagtga

DBGET integrated database retrieval system