KEGG   Aeromonas hydrophila pc104A: V429_22895
Entry
V429_22895        CDS       T03193                                 

Definition
(GenBank) primosomal protein N'
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    V429_22895
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_22895
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     V429_22895
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     V429_22895
SSDB
Motif
Pfam: PriA_3primeBD PriA_C DEAD Helicase_C PriA_CRR ResIII zinc-ribbons_6 AAA_30 TrwB_AAD_bind PIF1
Other DBs
NCBI-ProteinID: AHX71543
LinkDB
Position
4925220..4927427
AA seq 735 aa
MNSSQTLDLVRVAVPVPLRRHFDYLSPLPLPAPGCRVEIPFGPQTLVGLVVDHPADSQVP
RNKLKPIKRVLDSAPVLGPDILALMNWSASYYQHPLGEVLPHALPVLVRKGEPAAYRELE
FWFATEAGMAVDLNELKRAAKQQQALALLRKGPQTPSALKQEEIQSAALTALEKKGLLEK
RSLEPSHDGDWVARFEPGEGLRLNGEQALAVSAVTSQSDKFGAFLLDGITGSGKTEVYLS
ILEPLLKAGKQALVMVPEIGLTPQTINRFRRRFNVPVVAMNSAMNDRERLDAWLACRDGG
AAILIGTRSAVFTPFHNLGIIIIDEEHDGSFKQQDGFRYHARDLAVMRAHRAGIPILLGS
ATPSLETLHNARSGKYHHLTLTRRAGNAQTARQVILDIKNVRLQAGLSPQLEQLLAEHLA
AGNQVMLFLNRRGYAPALICHQCGWSAACERCDAWYTWHQAGRRLHCHHCDSVRPLPHHC
PECGSNELIGSGVGTEQLEQLLGTVFPQYPVVRIDRDNTRRKGELETHLGDIKAGKYKIL
IGTQMLAKGHHFPDVTLVGLLDVDGALFSADFRAAEKLAQLYTQVAGRAGRASKPGLVVL
QSHHPEHALLQDLTQNGYGHFADTALKERRLLGLPPFSYQGLFRAEANGRDEVQLFLSRL
ADTLRSARYPHVQVLGPISGFMERKAGKFRMQLLVQGPNRAPLAQLLDWAVKELEGWPET
KRVRWSLDIDPTELN
NT seq 2208 nt   +upstreamnt  +downstreamnt
gtgaattcttcccaaacgctggatctggttcgtgtggctgtgccggtgccgttacgccgt
cacttcgactatctatcccccctgcctttgcctgctcccggctgccgggtcgagatcccg
ttcggcccgcaaaccctagtcgggctggtggtggatcacccggccgacagccaggtgccg
cgcaacaagctcaagccgatcaaacgcgtgcttgatagcgcccccgtgctggggcccgac
attctggcgctgatgaactggagcgccagctactaccagcacccgctgggggaggtgctg
ccccacgccctgccggtgctggtgcgcaagggggagcccgccgcctaccgcgagctggag
ttctggttcgccaccgaggccggcatggcggtcgatctcaacgagctcaagcgggcggcc
aagcagcagcaggccctcgccctgctgcgcaaggggccgcagacgccatcagccctcaag
caggaggagatccagagtgccgccctcaccgcgctggagaagaaggggctgctggagaag
cgttcgctggagccgagccatgacggcgactgggtcgcccgcttcgagccgggcgagggg
ctgcgcctcaacggcgagcaggcgctggcggtctccgccgtcaccagccagagcgataag
ttcggtgcctttctgctcgatggcattaccggctccggcaagaccgaggtttacctgagc
atcctcgagcccctgctcaaggcgggcaaacaggcgctggtaatggtgcccgagatcgga
ctcactccacagaccatcaaccgcttccggcgccgcttcaacgtaccggtggtggcgatg
aactccgccatgaacgatcgggagcggctcgatgcctggctggcctgccgcgacggcggc
gccgccatcctgatcggcacccgctccgcggtgttcaccccgtttcacaacctcggcatc
atcatcatcgacgaggagcacgacggctccttcaagcagcaggacggctttcgctaccat
gcgcgggatctggcagtgatgcgggcccatcgcgccggcattcccatcctgctcggctcg
gccaccccgtcgctggaaacattgcacaacgcccgcagcggcaagtatcaccacctcacg
ctgactcgtcgcgccggcaatgcccagaccgcccgtcaggtgatcctggacatcaagaac
gtgcggctgcaggccgggctctccccccagctggagcagctgctggcagagcatctggcg
gccggcaatcaggtgatgctgttcctcaaccgccgtggctatgccccggctcttatctgc
caccagtgcggctggagcgccgcctgcgagcgctgcgatgcctggtacacctggcatcag
gccgggcggcgactgcactgccaccactgcgacagtgtgcgtccgctgccccaccactgc
cccgagtgtggcagcaacgagctcatcggctccggggtgggcaccgaacaactggagcag
ctgctcggcaccgtgttcccgcaatatccggtggtgcgcatcgatcgggacaacacccgt
cgcaagggggagctggagacccacctaggcgacatcaaggcgggcaagtacaagatcctg
atcggcacccagatgctggccaagggccaccacttcccggatgtgacgttagtggggctg
ctggatgtggatggcgctctattcagcgccgattttcgcgccgccgagaagctggcccag
ctctacacccaggtggcgggccgtgccggtcgcgccagcaagccggggctggtggtgttg
cagagccaccatccggagcacgccctgctgcaggatctgacccagaacggctatggccac
ttcgccgacacggcgctgaaggagcgccgcctgctggggctgccgccgttcagctatcag
gggctgtttcgggccgaggccaacggtcgcgacgaggtgcagctattcctcagccgtctc
gccgataccctgcgcagcgcccgttatccccatgttcaggtgctcgggcccatcagcggc
ttcatggagcgcaaggcgggcaagttccgcatgcagttgctggtgcaggggccgaaccgg
gcgccactggcccagctgctggattgggcggtgaaggagctggaggggtggcccgagacc
aagcgggtgcgctggagtctggatatcgaccccaccgagctgaactga

DBGET integrated database retrieval system