KEGG   Aeromonas hydrophila AL09-71: V428_06370
Entry
V428_06370        CDS       T03192                                 

Definition
(GenBank) LOG family protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
ahr  Aeromonas hydrophila AL09-71
Pathway
ahr00230  Purine metabolism
ahr00240  Pyrimidine metabolism
ahr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    V428_06370
   00240 Pyrimidine metabolism
    V428_06370
Enzymes [BR:ahr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     V428_06370
    3.2.2.-  
     V428_06370
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4 Glycos_transf_2
Other DBs
NCBI-ProteinID: AHX31712
LinkDB
Position
complement(1347557..1348912)
AA seq 451 aa
MITHINPVGSMDLLSQLEVDRLKQTASSDIYQLFRNCSLAVLNSGSHTDSSKEILERFKS
FDIHVIRRERGVKLELFNAPEHAFVDGEIIRGIQEHLFSVLRDILYVSTQLESNRLVNLT
SSTHISNVVFAILRNAKAILPGADPNLVVCWGGHSINEIEYQYTRAVGSELGLRELNICT
GCGPGAMEGPMKGAAVGHAKQRVRNGRYIGLTEPSIIAAEPPNPIVNELVILPDIEKRLE
AFVRLGHGIIIFPGGVGTAEELLYLLGIMMHPANERQPMPIILTGPKESADYFRAIDDFV
KATLGEPATSLYRIIVGDAPEVARVMKEAMPKIREYRKSVGDAYSFNWSLKIEPEFQLPF
EPDHANMASLDLHRNQPPQLLAANLRRAFSGIVAGNVKEGGIRAIEKKGPFKLHGDKELM
HLMDKLLESFVKQQRMKLPGSQYVPCYEIVR
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgattacgcacatcaatccagtcggcagcatggacttgctgtcccagctcgaggtggac
cgcctcaagcaaaccgcctccagcgatatctatcaactgtttcgcaactgctcgctggcg
gtactcaactccggcagccataccgacagctccaaagagatactggagcgcttcaaatcc
ttcgatattcatgtgatccggcgcgagcgcggggtcaagctcgagctgttcaacgccccc
gagcacgccttcgtcgatggcgagatcatccgcggcattcaggagcacctgttctccgtc
ctgcgcgacatcctctacgtgtcgacccagctggagtcgaaccggctggtcaacctgacc
agctccacccacatctccaacgtggtgttcgctatcctgcgcaacgccaaggcgatcctg
cctggcgccgatcccaatctggtggtttgctggggcggtcactccatcaacgagatcgag
taccagtacacccgcgcggtaggcagcgaactgggcctgcgtgagctcaacatctgcacc
ggctgcggcccgggcgccatggagggcccgatgaagggcgccgccgtcggccacgccaag
cagcgggtgcgcaacggccgctacatcggcctcaccgagccttccatcatcgccgccgag
ccgcccaaccccatcgtcaacgagctggtgatcctgccggacatcgagaaacggctggag
gccttcgtgcgcctcggccacggcatcatcatcttcccgggcggggttggtaccgccgaa
gagctgctctacctgctcggcatcatgatgcacccggccaacgagcggcagcccatgccg
atcatcctgaccggcccgaaggagagcgccgattacttccgcgccatcgacgacttcgtc
aaagcgaccctgggcgaaccggccaccagcctctaccggatcatcgtcggcgatgccccg
gaagtggcccgggtcatgaaagaggcaatgccgaagatccgcgaataccgcaaatcggtc
ggcgatgcctactccttcaactggtcgctcaagatcgagccggagttccagctgccgttc
gagccggatcacgccaacatggccagcctggatctgcaccgcaaccagccgccccagttg
ctggcggccaacctgcgccgtgccttctccggcatcgtcgccggcaacgtcaaggaaggg
ggcatccgcgccatcgagaagaagggtcccttcaagctgcacggcgacaaggagctgatg
cacctgatggacaagctgctggagagcttcgtcaagcagcagcgcatgaagctgccgggc
agccagtatgtgccctgctacgaaatcgtgcgctga

DBGET integrated database retrieval system