KEGG   Aeromonas hydrophila AL09-71: V428_07815Help
Entry
V428_07815        CDS       T03192                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ahr  Aeromonas hydrophila AL09-71
Brite
Enzymes [BR:ahr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     V428_07815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AHX31995
LinkDB All DBs
Position
complement(1681504..1682085)
Genome map
AA seq 193 aa AA seqDB search
MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTS
TGGIFNNAAQIWNHTFYWHCLSPNGGGEPTGALADAITKAFGSFAEFKDAFTKSAIGNFG
SSWTWLVKKADGSLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYMETFW
TLVNWEFVAKNLA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaacttcccgctctgccctatgcaatcaatgctctggaaccgcacatctcc
caggaaactctggaataccaccacggcaagcaccacaacacctatgtggtcaacctgaac
aacctggtgccgggtaccgagtttgaaggcaagtctctggaagagatcatcaagacctcc
actggcggcatcttcaacaacgccgcccagatctggaaccacaccttctactggcactgc
ctctccccgaacggcggtggcgagcccactggcgccctggccgatgccatcaccaaggcc
ttcggctccttcgccgagttcaaggatgcgttcaccaagtctgccatcggcaacttcggt
tccagctggacttggctggtgaaaaaggctgacggctccctggccatcgtcaacacctcc
aacgccggttgcccgctgaccgaagccggtaccactccgctgctgaccgtcgacctgtgg
gaacacgcctactacatcgatttccgcaacctgcgtccgaagtacatggaaaccttctgg
accctggtcaactgggaattcgtggccaagaacctggcctga

DBGET integrated database retrieval system