KEGG   Aeromonas hydrophila AL09-71: V428_11260Help
Entry
V428_11260        CDS       T03192                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ahr  Aeromonas hydrophila AL09-71
Pathway
ahr00473  D-Alanine metabolism
ahr00550  Peptidoglycan biosynthesis
ahr01100  Metabolic pathways
ahr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ahr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    V428_11260
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    V428_11260
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    V428_11260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ahr01011]
    V428_11260
Enzymes [BR:ahr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     V428_11260
Peptidoglycan biosynthesis and degradation proteins [BR:ahr01011]
 Precursor biosynthesis
  Amino acid ligase
   V428_11260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AHX32650
LinkDB All DBs
Position
2427828..2428817
Genome map
AA seq 329 aa AA seqDB search
MKNIHVLLLCGGGGSEHEVSLRSANFLEQQLGLLPGVDVTRVEMFADRWLSADGRECKLG
LDKLLSFDSVARPVDYVVPCIHGYPGETGDLQSFLELAGLPYLGCDAEASKICFNKISTK
LWLSAIGIPNTPYLFLTEQNDAALSEAKAALAKWGKVFIKAASQGSSVGCYSASNEADLV
KGIADAFGYSEQVLIEKAVKPRELEVAVYQYGDELVATYPGEICVPQDKFYTYEEKYSSA
SHTETALRAEGLTQAQADAIHEYALKAFRQLKLTHLSRIDFFLTEEGEILLNEINTFPGM
TSISMFPKLLEHHGHRFADYLEQILRKAV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatccatgtcttgctgctgtgcggcggcggtggctccgagcacgaagtctct
ctgcgaagcgcaaattttctcgagcaacagctcggtcttttgcctggggtcgacgtgacc
cgggtcgagatgtttgccgaccgctggctcagcgccgacggccgcgaatgcaagttgggg
ctggacaagctgctgtcgtttgacagcgtggcccgtccggtggactacgtggtgccctgc
atccacggctaccctggcgagaccggtgacctgcaatccttcctcgagctggcgggcctg
ccttatctgggctgcgatgccgaggcgagcaagatctgcttcaacaagatcagcaccaag
ctgtggctctccgccatcggcatccccaacaccccttatctgttcctgaccgagcagaac
gacgcggcgctgagcgaggcgaaagccgcgctggccaagtggggcaaggtcttcatcaag
gcggcctcccagggttcctccgtcggctgctactccgccagcaacgaagcggatctggtg
aagggcattgccgatgccttcggttactccgagcaggtgctgatcgaaaaagcggtcaag
ccgcgcgagctggaagtggcggtgtaccagtacggtgacgagctggtggccacctacccg
ggcgagatctgcgtgccgcaggacaagttctacacctatgaagagaagtacagcagcgcc
agtcacaccgagaccgcactgcgtgccgaggggctgacccaggcgcaggctgacgccatt
cacgagtacgccctcaaggcgttccgtcagctcaaactgacccacctgtcgcgcatcgac
ttcttcctgaccgaagagggcgagatcctgctgaacgaaatcaacaccttcccgggcatg
acctccatctccatgttcccgaaactgctggagcatcacggtcaccgcttcgccgattac
cttgagcagatcctgcgcaaggcagtctga

DBGET integrated database retrieval system