KEGG   Aeromonas hydrophila AL09-71: V428_14330Help
Entry
V428_14330        CDS       T03192                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ahr  Aeromonas hydrophila AL09-71
Pathway
ahr00473  D-Alanine metabolism
ahr01100  Metabolic pathways
ahr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ahr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    V428_14330
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    V428_14330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ahr01011]
    V428_14330
Enzymes [BR:ahr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     V428_14330
Peptidoglycan biosynthesis and degradation proteins [BR:ahr01011]
 Precursor biosynthesis
  Racemase
   V428_14330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHX33204
LinkDB All DBs
Structure
PDB: 

Position
3113697..3114923
Genome map
AA seq 408 aa AA seqDB search
MHKKTLLATLILGLLAGQAVAAPYLPLASDHRNGEVQTASNAWLEVDLGAFEHNIQTLKD
RLGDKGPKICAIMKADAYGHGIDLLVPSVVKAGIPCIGIASNEEARVAREKGFTGRLMRV
RAATPAEVEQALPYKMEELIGSLVSAQGIADIAQRHHTNIPVHIALNSAGMSRNGIDLRL
ADSKEDALAMLKLKGITPVGIMTHFPVEEKEDVKMGLAQFKLDSQWLLEAGKLDRSKITI
HAANSFATLEVPDAYFDMVRPGGLLYGDSIPSYTEYKRVMAFKTQVASVNHYPAGNTVGY
DRTFTLKRDSWLANLPLGYSDGYRRALSNKAYVLIQGQKVPVVGKTSMNTIMVDVTDLKG
VKPGDEVVLFGRQGEAEVKQADLEEYNGALLADMYTIWGYTNPKKIKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagaagacactgctggccacgctgatcctgggcctgctggccggtcaggccgtc
gcggccccttacctgccgctggccagcgatcatcgcaacggcgaagtgcagaccgccagc
aatgcctggctggaagtcgatctcggcgccttcgaacacaacatccagaccctcaaggat
cgcctcggtgacaaagggcccaagatctgcgccatcatgaaggcagacgcctacggccac
ggcatcgacctgctggtgccctcggtggtcaaggccggcatcccttgcatcggcatcgcc
agcaacgaagaggcccgcgtggcccgcgagaagggcttcaccggccgcctgatgcgggtg
cgtgccgctaccccggccgaagtggaacaggccctgccctacaagatggaagagctcatt
ggcagcctggtgagtgctcagggcatcgccgacatcgcccagcgccaccacaccaatatc
ccggtgcacatcgcgctcaactccgccggcatgagccgcaacggcatcgatctgcgtctg
gctgactccaaggaagacgcgctggccatgctcaagctcaaggggatcaccccggtcggc
atcatgacccacttcccggtggaggagaaagaggacgtcaagatggggctggcccagttc
aagctggactcccagtggctgctggaagcgggcaagctggatcgcagcaagatcaccatc
cacgccgccaactccttcgccactctggaagtgccggacgcctacttcgacatggtgcgc
ccgggcggcctgctctacggtgactccatcccctcctacaccgagtacaagcgggtgatg
gcgttcaagacccaggttgcctccgtcaaccactacccggccggcaacactgtcggttat
gaccgcaccttcaccctcaagcgcgactcctggctcgccaacctgccgctgggctactcc
gacggctatcgccgggcgctgagcaacaaggcctatgtgctgatccagggccagaaggtg
ccggtggtgggcaagacctccatgaacaccatcatggtggacgtgaccgatctcaaaggg
gtcaaacccggtgacgaggtggtgctgttcggccgccagggtgaggccgaggtgaaacag
gcggatctcgaggagtacaacggcgccctgctggcggacatgtacaccatctggggctac
accaaccccaagaagatcaagcgctaa

DBGET integrated database retrieval system