KEGG   Arcobacter halophilus: AHALO_1040Help
Entry
AHALO_1040        CDS       T05822                                 

Definition
(GenBank) glycosyl hydrolase, family 3
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ahs  Arcobacter halophilus
Pathway
ahs00520  Amino sugar and nucleotide sugar metabolism
ahs01100  Metabolic pathways
ahs01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ahs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AHALO_1040
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AHALO_1040
Enzymes [BR:ahs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AHALO_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Ribosomal_L27A
Motif
Other DBs
NCBI-ProteinID: AXH09422
UniProt: A0A2N1J4T6
LinkDB All DBs
Position
1048332..1049414
Genome map
AA seq 360 aa AA seqDB search
MKKFLFIFLLYSLNCFATSSFNEEVVKKQIAKMLIVGFDKTSIDNFSQIAKDIKKYELAG
VILFDKNLEDKTKPKNIKSFAQVKQLTKDLQSLVPYKLLIAIDQEGGKVQRLKKIYGFKE
TKSAKEVAKLPINKVNEEYKNLALQLSDLGINLNFAPVVDLAINPNNEVITKLDRAYSKD
ANETVKYAKLLIKEQRKKHIISVLKHFPGHGSSLKDSHKGFVDISNTWSKYELKPYEKLI
KQCKIDMIMTAHVFNKNLDENYPATLSYNVNTKLLREKLGFKGVIISDDLQMKAISKHYS
LNKTVSLAINSGVNILLFGNQLAKYKTSDIINTIYEELLKGNISYERILVSNRLIKSISK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttttatttatttttcttttatatagtttaaattgttttgcaacaagctct
tttaatgaagaagttgttaaaaaacaaatagcaaagatgttaatagttggttttgataaa
acatcaatagataatttttctcaaatagcaaaagatataaaaaagtatgaattagcagga
gttattttatttgataaaaatttagaagataaaacaaaacctaaaaatatcaaatctttt
gctcaagtaaaacagttaaccaaagatttacaaagtttagtgccttataaacttttaatt
gccattgaccaagagggtggtaaagttcaaagattaaaaaaaatatatggttttaaagag
acaaaaagtgcaaaagaagttgctaaattacctataaataaagtgaacgaagagtataaa
aacttagctttacaattaagtgatttgggaataaatttaaattttgcacctgttgttgat
ttggcaataaatccaaataatgaagttattactaaattagatagagcatactcaaaagat
gctaatgagactgtaaagtatgcaaaattattaattaaagaacaaagaaaaaaacatatt
ataagtgttttaaaacactttccaggtcatggttcatctttaaaagattcccataaaggg
tttgtagatatttcaaatacttggagtaaatatgaattaaaaccatatgaaaaattaata
aaacagtgcaaaatagatatgattatgacagctcatgtttttaacaaaaacttagatgaa
aattatcctgcaactttatcttataatgtaaatacaaaattgttaagagaaaagttaggt
tttaaaggagtaataataagtgatgatttgcaaatgaaagctatatctaaacattatagt
ttaaataaaactgtaagtttagctataaattcaggggttaatatacttttatttggaaat
caattagctaaatataaaactagtgatattattaatactatttatgaagagcttttaaaa
ggtaatatctcttatgaaagaattttagtttcaaatagattgattaaatcaataagtaaa
taa

DBGET integrated database retrieval system