KEGG   Arcobacter halophilus: AHALO_1176Help
Entry
AHALO_1176        CDS       T05822                                 

Gene name
sbcC
Definition
(GenBank) DNA repair exonuclease SbcCD, ATPase subunit
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
ahs  Arcobacter halophilus
Brite
KEGG Orthology (KO) [BR:ahs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahs03400]
    AHALO_1176 (sbcC)
DNA repair and recombination proteins [BR:ahs03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AHALO_1176 (sbcC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SbcCD_C AAA_29 BLOC1_2 ABC_tran
Motif
Other DBs
NCBI-ProteinID: AXH09553
UniProt: A0A2N1J5Y6
LinkDB All DBs
Position
1178006..1181167
Genome map
AA seq 1053 aa AA seqDB search
MKILKVKLLNINSLKGEFEIDFQEFLKDESLFAITGPTGAGKSTILDVITCALYGRTARL
TNPNDLMSRHTGECLCEVEFEIKGKVYRSSWAQKRARKNPNGNFQSAKMEIVELDTNKIL
ESYLSKVPKVVEEISGLDFDRFVQSMMLAQGSFDAFLKAKENERSNLLEKITGTYIYKQI
SQSIYETYSSKKKEIEADEIALGSIELLEPEIAEEKTKQLETNKKEKQELDKKETELKKL
SNYLETLAKLEADSQKYNQEFEQISKEKENNKEQFTKLELANKAIRIQALNQEKNQLINT
ITNDKQSLESLQKEDKELKEQIQTKEQEFKLSKQSLEKEQTTYNENYKKLKELRTIKTQS
DGKNSLYVEKSKKISQHLQELAKHFEIAFETLLNDESQIDNLYKNFSSNLDTKKEQLETL
IEEYKALETKTKDINQKEQNTRAKLKEIEALLKALSDYEILQEQITQEQNKIKEYNAQIE
SQTKLNQEKTKLISQINETLTSLKQTREKELLIKNYEQDRAKLKDGQECFLCGSKEHPYI
NHSLNIDTEISQTLAKIKEQENYLQEQNSELNNAQINLAKLSSKLESSNLELQKQQTTKE
QIEEYFKTNDFKLQEDSKTTLQEQMQFCENELKEYVTLREQKESLQTKKESLQTSLNKEL
QKQQQINTSINTIKELKEEQTKLKEEITKLQTQSKNILDIEDLDLFEKNIQESLDTVSKH
FNNLQNHLSSLKSKDESLSKQIIQLNQKQEDDKQTLVLIKEKFEKALVEYGFSSQEEFEK
ANLPKEEFETLTKLCKTIEEKYTQIQTLKTDTNKKLKEHKLLEKEINPTNQNKDDINKEL
QNLQSTIDQLQESIGSISKELEINTQNIKKSEDKIKQLEKKKQAFQVWVKLNDMIGSSQG
DKFAKFAQGITLDQLIYLANKHLEILSPRYELQRNTQSNKLLDIEIIDGFQGDAVRGVNT
LSGGESFIVSLSLALGLSSLASQKISIDSLFLDEGFGTLDSDSLELALNALNQLQSSGKM
VGVISHVEALKERIPLQIKVEPKGDGTSGLDLN
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgaagatactaaaagtaaaattactaaatataaactccctaaaaggtgagtttgaaata
gactttcaagagtttctaaaagatgaatctctttttgccataactggaccaacaggagca
gggaaaagtacaattttagatgtaatcacttgcgccttatatggaagaacagccagacta
acaaacccaaatgacctgatgagtagacacacaggggagtgtttatgtgaagtagagttt
gaaatcaaaggcaaagtttatagaagttcttgggcgcaaaaaagagcaagaaaaaatcca
aatggaaatttccaatctgcaaagatggagatagtagaactagacacaaataaaatacta
gaatcatacctttcaaaagtaccaaaggttgtagaggaaatctcagggcttgattttgat
aggtttgttcaatctatgatgttagcccaaggaagttttgatgcctttttaaaagccaaa
gaaaacgagcgttcaaacctactagaaaagattactggaacatatatctacaaacaaatc
tcacaaagtatctatgaaacatactcgtcaaagaaaaaagagatagaagcagatgaaata
gcactaggaagtatagaattactagaaccagaaatagcggaagagaaaacaaaacaacta
gaaacaaacaaaaaagaaaagcaagaattagataaaaaagaaacagaactaaaaaaacta
tcaaactatctagaaaccctagctaaactagaagcagatagccaaaagtacaatcaagag
tttgagcaaataagcaaagaaaaagaaaacaacaaagagcagtttacaaagctagaactt
gcaaataaagccataagaatacaagctttaaaccaagagaaaaatcaactaataaacaca
atcacaaatgataaacaaagcttagaatctttgcaaaaagaagacaaagagttaaaagaa
caaattcaaacaaaagagcaagagtttaaactttctaaacaaagccttgaaaaagagcaa
acaacatacaatgaaaactataaaaaactaaaagagctaagaacaataaaaacacaaagc
gatggtaaaaactctttatatgtagaaaaaagtaaaaaaatatcacaacacttacaagag
ttggcaaaacattttgagatagcttttgaaacacttttaaatgacgaatcacaaatagac
aatttatacaaaaacttctcatcaaatctagacacaaaaaaagagcagttagaaacgcta
atagaagaatataaagcactagaaacaaaaacaaaagatataaaccaaaaagagcaaaac
acaagagccaaactaaaagagatagaagcacttctaaaagccctaagtgattatgagata
ctacaagaacaaatcacacaagaacaaaacaagataaaagagtacaacgctcaaatagaa
tcacaaacaaaactaaaccaagaaaaaacaaaactaataagccaaataaacgaaactcta
acttcactaaaacaaacaagagaaaaagaacttcttatcaaaaactacgagcaagataga
gccaaactaaaagatgggcaagagtgctttttatgtgggtcaaaagagcatccatatata
aaccactctttaaatatagatacagagataagtcaaacactagccaaaataaaagagcaa
gaaaactatctacaagagcaaaacagcgaactaaacaacgctcaaataaacctagcaaaa
cttagctcaaaacttgaaagctcaaacctagaactacaaaaacaacaaactacaaaagag
caaatagaagagtactttaaaacaaatgatttcaaactacaagaagactcaaaaaccaca
ctacaagagcaaatgcaattttgcgaaaatgagctaaaagagtatgtaactttaagagag
caaaaagagtctttacaaacaaaaaaagagtctctacaaacatctttaaataaagagctg
caaaaacaacagcagataaatacaagcataaacacaataaaagagctaaaagaggaacaa
acaaaactaaaagaagagataacaaagcttcaaacccaaagcaaaaatatcttagatata
gaagatttagacctttttgagaaaaatatccaagagagtttagatactgtttcaaaacac
tttaacaatttgcaaaaccatctttcaagcctaaaatcaaaagatgaatctctctcaaaa
cagataatccaactaaaccaaaaacaagaagatgacaaacaaaccctagtactcataaaa
gagaagtttgaaaaagctttagtagagtatggctttagttcacaagaggagtttgaaaaa
gcaaacctaccaaaagaagagtttgaaaccttaacaaagctatgcaaaaccatagaagag
aaatacactcaaatacaaactctaaaaacagacacaaacaaaaaactaaaggaacacaaa
ctcttagaaaaagagataaacccaacaaatcaaaacaaagatgatataaacaaagagtta
caaaacctacaaagtacaatagaccaactacaagaatccataggaagtatctcaaaagag
ttagagataaatacccaaaatataaaaaaatcagaggacaaaatcaaacaacttgaaaag
aaaaaacaagcctttcaagtatgggtaaaactaaatgatatgataggctcaagccaaggg
gacaagttcgctaaatttgcccaaggtataaccctagaccaattaatctatctagcaaat
aaacacttagaaatactaagcccaagatatgaactccaaagaaacacccaatcaaacaaa
ctcttagatatagagataatagacggcttccaaggtgacgcggtaagaggtgtaaacaca
ctctcagggggagaaagcttcatagtaagtctatctttagccttaggactatcaagtcta
gcaagccaaaagataagtatagactcacttttcctagatgaagggtttggaacactagat
agcgatagcctagagctggcactaaatgcactaaatcaactacaaagttcaggaaaaatg
gtaggtgtgatttcccacgtggaagcactaaaagagcgaattccattgcagataaaggtt
gagcctaagggtgatgggacgagtggtttggatttaaattag

DBGET integrated database retrieval system