KEGG   Antarctobacter heliothermus: ANTHELSMS3_00728Help
Entry
ANTHELSMS3_00728  CDS       T04983                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
aht  Antarctobacter heliothermus
Pathway
aht00240  Pyrimidine metabolism
aht01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aht00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    ANTHELSMS3_00728 (tdk)
Enzymes [BR:aht01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ANTHELSMS3_00728 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_14
Motif
Other DBs
NCBI-ProteinID: ASP19446
UniProt: A0A222DZS7
LinkDB All DBs
Position
complement(738844..739431)
Genome map
AA seq 195 aa AA seqDB search
MAKLHFQYSTMNAGKSTLLLQAAHNYNERGMDTYLLTAAIDSRAGDGMIGSRIGLSRPAE
IFDPQTDLYARIAARLDAGPVACIFIDEAQFLTRDQVWQLARVVDDLGVPVMAYGLRVDF
RGELFPGSAALLALADEMREVRTICHCGRKATMVIRQGADGAVLTDGEQVQIGGNETYVS
LCRRHWREVTGDRAE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctgcactttcaatactcgaccatgaacgcgggcaaatcgacgctgctgttg
caggcagcgcacaactacaatgaacgcggcatggacacctacctgttgacggcggcaatc
gacagccgtgccggggacggcatgatcggctcccggatcgggttgtcgcgcccggcagag
atctttgatccgcagacggatctttatgcccgcatcgcggcgcggctggacgccggtccg
gtggcctgcatctttatcgacgaggcgcagttcctgacccgcgatcaggtctggcaattg
gcgcgggtggtcgatgatctgggggtgccggtcatggcctacgggctgcgggtcgatttt
cgcggagagttgttccccggctcggcggcgctgttggcgttggcggatgaaatgcgtgag
gtgcgcacgatctgccactgcgggcgcaaggcgacaatggtgattcgtcagggcgcggat
ggtgcggtgctgactgacggggaacaggtgcagatcggtggcaatgaaacctacgtcagc
ctgtgccgcaggcactggcgagaggtcacaggcgaccgcgccgaatag

DBGET integrated database retrieval system