KEGG   Antarctobacter heliothermus: ANTHELSMS3_01871Help
Entry
ANTHELSMS3_01871  CDS       T04983                                 

Definition
(GenBank) 3-ketoacyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aht  Antarctobacter heliothermus
Pathway
aht00061  Fatty acid biosynthesis
aht00780  Biotin metabolism
aht01100  Metabolic pathways
aht01130  Biosynthesis of antibiotics
aht01212  Fatty acid metabolism
Module
aht_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aht00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ANTHELSMS3_01871
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ANTHELSMS3_01871
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ANTHELSMS3_01871
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aht01004]
    ANTHELSMS3_01871
Enzymes [BR:aht01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ANTHELSMS3_01871
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ANTHELSMS3_01871
Lipid biosynthesis proteins [BR:aht01004]
 Fatty acid synthase
  Component type
   ANTHELSMS3_01871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ASP20557
UniProt: A0A222E2Y7
LinkDB All DBs
Position
1950793..1951581
Genome map
AA seq 262 aa AA seqDB search
MTLSLKGKRGLVMGVANERSIAWGIAKACHEAGAELAFTYQGEAFGKRLEPLAASVGSDF
MVDVDVTDDASLDAAFDELGQRWDSVDFLVHAIAYSDKNELTGRFLNTSRANFKNSLDIS
VYSFIEVARRVHPLMTDGGTLLTLTYLGSQRVVPNYNVMGVAKAALEATTRYLANDLGPD
GIRVNALSPGPMKTLAGAAIGGARRTYKHTGQNAPLRANATLEAVGGTAVWLLSDAGSCT
TGEVIMVDGGYHVVGMPQLENL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgagtctgaaaggcaagcgcgggcttgtcatgggtgttgcgaacgagcggtcg
atcgcatggggcatcgccaaagcctgccatgaggcgggcgcggaactggcctttacctat
cagggagaggcgttcggcaagcggctggagcctttggcggccagcgtcgggtcggatttc
atggtcgacgtggatgtgacggatgatgcgtcgctggacgcggcgtttgatgagttgggt
cagcggtgggacagcgtggatttccttgtccatgcgattgcctattcggacaagaatgag
ctgacggggcggtttctgaacacgtcgcgggcgaactttaagaactcgctggatatttcg
gtgtattcgttcatcgaggtggcccggcgggtgcatccgctgatgacggacggtggcacg
cttttgacgctgacctatctgggcagccagcgggtggtgccgaactacaacgtcatgggc
gtggccaaggcggcgctcgaggcgacgacacgttatctggccaatgatctgggcccggat
ggcatccgcgtgaacgcgctcagccccggaccgatgaaaacgctggcgggggcggccatc
ggcggcgcgcggcggacctacaagcacaccggccagaatgcgcctttgcgggcgaacgcc
acgctggaggcggtgggcggcacggcggtctggctgctctcggatgcgggcagttgcacc
acgggtgaggtgatcatggtggacggtggctatcacgttgtggggatgccgcaactggag
aacttgtga

DBGET integrated database retrieval system