KEGG   Antarctobacter heliothermus: ANTHELSMS3_02557Help
Entry
ANTHELSMS3_02557  CDS       T04983                                 

Definition
(GenBank) trypsin-like peptidase domain protein
Organism
aht  Antarctobacter heliothermus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 Trypsin PG_binding_1 PG_binding_2 Peptidase_C4
Motif
Other DBs
NCBI-ProteinID: ASP21220
UniProt: A0A222E515
LinkDB All DBs
Position
2631754..2633340
Genome map
AA seq 528 aa AA seqDB search
MSIVRLAAAALLITYANTAPAQDLMLFPPSTFGQVVAPQTESLLGDVQLEAQVGAYNNEF
ISNYGPNSVFARTGRAVGMLQILTNVGHAPCTGFLVEGNKLITNHHCVPGILKNPQMIEK
GATSIAAVQFHAGFLRDGLDDGVKTFHVNPVPLETSEALDYTVLQVLGDANAEFGALELS
AAAPQDRDPFWVIGHPMGEAQRISREKCQADSPALAKQRLRHTCDTLPGNSGSPVIDAGS
QKVIALHHAGSRAGEVNFAVPMAEILAQSNVLTAAVQPPAAPDADKLDAEKALAEALAEL
EKLRSERAAAVLVPPAEEPVAEPVAEAVPVPAAEPVETEASRRDILRQSQAQLNALGCDA
GTPDGIMGPRTREAFRRFLAESDVALEVSDLGTAQALDAIRARSGTVCAPVVVAPKPVSR
DAAEPVAAPKPAAPTYSMAGSWRWTATCPLGQATGTTVYRSAGGNSFTGTISGSSGAGTT
RGVLSGRNFSGTETFGWVTNSANGTLSADGRSLNLSVSNGCSVSARKN
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgttcgccttgccgccgccgctttgttgattacctatgccaataccgccccg
gcgcaggatctgatgctgttcccgccgtccacgttcgggcaggtcgtcgcgccgcagacg
gaatccctgctgggcgatgtgcagctagaggcgcaggtgggggcctataacaacgagttc
atttccaattatgggccgaattcggtctttgcgcgcacgggacgcgcggtggggatgttg
cagattctgaccaatgtgggccacgcgccctgcaccgggtttctggtggagggcaacaag
ctgatcaccaaccaccattgcgtgcccggcatcctgaaaaacccccagatgatcgaaaag
ggggccaccagcatcgcggcggtgcaattccatgcggggtttctgcgcgacgggctggac
gacggggtaaaaacattccacgtcaacccggtgccgctggagacaagcgaggcgctggat
tacacggttctgcaagtgctgggcgatgccaatgccgagttcggcgcgctggaactgtcg
gcggctgcgccgcaggaccgcgatccgttctgggtgatcggtcacccgatgggcgaggcg
cagcgcatcagtcgcgaaaaatgtcaggcggacagcccggctttggcgaaacagcggctg
cggcatacctgcgatacgttgccggggaattccggctctccggtgatcgacgcgggcagc
caaaaggtgattgcgctgcaccatgcgggcagccgtgcgggtgaggtgaatttcgccgtg
ccgatggccgagattctggcgcagtccaatgtattgacggcggcagtgcagccgccagcg
gcaccggatgccgacaaactggacgcggaaaaggcgctggccgaggcgctggcggagttg
gagaagctgcggtctgaacgggctgctgctgtgcttgtcccgcctgctgaagagccggta
gcggaacccgttgcggaagctgttccggttccggctgcggaaccagttgagaccgaggcg
agccgccgtgacatcctgcgtcagtcgcaagcacaactgaacgcgctgggctgtgacgcg
ggcacaccggacgggatcatgggcccgcgcacgcgcgaggcgtttcgccgctttctggcg
gagagcgatgtggcgctggaggtcagcgatctggggacggcgcaggcgctggatgcgatc
cgggcgcggtccgggacggtctgcgccccggtcgtggtggcccccaagccggtatctagg
gacgcggcggagccggtcgcggcgcccaagcctgccgcgccgacctattccatggccgga
tcatggcgctggacggcaacctgtccgttggggcaggcgaccggaaccaccgtttatcgg
tcggcgggcggcaattcctttaccggcacgatcagcggctcatccggcgcaggcaccacg
cggggcgttttgagcggccgcaatttctcggggacggagacatttggttgggtgacaaac
tctgccaacggcaccttgtcggcggatggccggtcgctgaatctgagcgtctcgaatggg
tgcagcgtctcggcgcgcaagaactag

DBGET integrated database retrieval system