KEGG   Antarctobacter heliothermus: ANTHELSMS3_04264Help
Entry
ANTHELSMS3_04264  CDS       T04983                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aht  Antarctobacter heliothermus
Pathway
aht00473  D-Alanine metabolism
aht00550  Peptidoglycan biosynthesis
aht01100  Metabolic pathways
aht01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aht00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ANTHELSMS3_04264 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ANTHELSMS3_04264 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ANTHELSMS3_04264 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aht01011]
    ANTHELSMS3_04264 (ddl)
Enzymes [BR:aht01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ANTHELSMS3_04264 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:aht01011]
 Precursor biosynthesis
  Amino acid ligase
   ANTHELSMS3_04264 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ASP22868
UniProt: A0A222EA00
LinkDB All DBs
Position
complement(4432177..4433091)
Genome map
AA seq 304 aa AA seqDB search
MSSRTIPKVVVLKGGPSSEREVSLVSGRECAAALRGEGYEVIELDAGPDVAERLAVLTPD
VVFNALHGRWGEDGCIQGILEWLRIPYTHSGVLASALAMDKEKTKDVYRAAGLPVAESLL
ARADEVRARHVMTPPYVVKPYNEGSSVGVYLVDEAANGPPALDAAMPEVVMVEAFVPGRE
LTTTVMGDRALGVTDIVTEGWYDYDAKYKTGGSRHVCPAEVPQEITDACLDYALRAHKAL
GCRGVSRTDFRWDEARGLAGLILLETNTQPGMTPTSLSPEHGALVGMSFGQFCGWMVEEA
SCDR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaggacaatcccgaaagtggtggtgttaaaaggtggtccctcgtcagagcgc
gaggtctcgcttgtttccggtcgggaatgcgccgccgctttgaggggcgaaggatacgag
gtgattgaactggacgcgggccccgatgtggccgagcggctggcagtgctcaccccggac
gtggttttcaacgcattgcatgggcgctggggggaagacggctgtattcagggtatcctg
gagtggctgcgcatcccctatacgcattccggggttctggcctcggcccttgcgatggac
aaggaaaagaccaaggacgtgtaccgcgccgccgggttgccggtggccgagagcctgctg
gcgcgggccgatgaggtgcgcgcgcgccatgtgatgacgccgccctatgtggtgaaaccc
tacaatgagggatcgtcggtcggggtctatctggtggatgaggcggccaacgggccgcca
gcgctggatgcggcgatgcccgaggttgtcatggtcgaggcctttgtgccggggcgtgag
ttgaccacaaccgtgatgggggaccgggcgctgggcgtgacggatatcgtcaccgagggc
tggtacgactacgacgcgaaatacaagaccggtgggtcgcggcatgtctgccccgccgag
gtgccgcaagagatcaccgacgcctgtctggattacgccctgcgcgcccataaggcactg
gggtgccggggcgtgtcgcgcaccgatttccgctgggatgaggcgcgcgggctggccggg
ttgatcctgctggagacgaacacgcagccgggcatgacgccgacgtccttgtcaccagag
cacggcgcgctggttgggatgagctttggccagttctgcggctggatggtcgaggaggcc
tcatgcgacaggtag

DBGET integrated database retrieval system