KEGG   Antarctobacter heliothermus: ANTHELSMS3_04456Help
Entry
ANTHELSMS3_04456  CDS       T04983                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
aht  Antarctobacter heliothermus
Brite
KEGG Orthology (KO) [BR:aht00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ANTHELSMS3_04456
Enzymes [BR:aht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     ANTHELSMS3_04456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ASP23056
UniProt: A0A222EA56
LinkDB All DBs
Position
4609990..4611021
Genome map
AA seq 343 aa AA seqDB search
MKTIVAHGAHDLRIEEKDMPTPGPGQVLIRLESGGICGSDLHYYHQGGFGPVRLKEPMIL
GHEVAGKIETLGPNVTSLALGQRVAVSPSRPCHACRFCHAGQPNHCLNMRFYGSAMPFPH
IQGAFREYLVADVAQCAPADDLTAGEAAMAEPLAVVLHAAKRAGDLLGKRVLVTGCGPIG
ALAVLVARAAGAAEIVATDLTDFTLKMATQVGADRVVNMGTTPDGLSAYTADKGQIDVLF
ECSGAAPALIAAIPAMRPGGIIMQLGLGGDMTLPVQALTAKELQLRGSFRFHEEFFTAVD
LMRSGRIDVKPLITHEVGLDQAEDGFKLASDRTQAMKAQIRFS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatcgtcgcccacggcgcgcatgacctcaggatcgaagagaaagacatgccc
acgcccggccccggtcaggtcctgatccggctcgaatccgggggcatctgcggctctgac
ctgcattattatcatcaaggcggcttcggcccggttcgcctgaaagagccgatgatcctc
ggccacgaagtcgcgggcaagatcgaaacgctaggcccaaacgtcacctcgctggccctc
ggccaacgcgtcgccgtctccccctcgcgcccctgccatgcctgccgcttttgccacgca
ggccaacccaatcactgcctcaacatgcgcttttacggctccgccatgcccttcccccat
attcagggtgcctttcgcgaatatctcgtcgccgacgtggcccaatgcgcccccgccgat
gacctaaccgccggtgaggccgcgatggcagaacccctcgcggttgtcctccacgccgcc
aaacgggcgggcgatctgctgggcaaacgggtgctggtgacaggctgcggccccatcggc
gcgctggccgtgctggtcgcccgcgccgcaggcgcggcagagatcgtggcgacagacctg
accgatttcacgctgaagatggccacacaggtcggcgcggaccgcgtggtcaacatgggc
acaacccccgacggattgtccgcctataccgccgacaaaggccagatcgacgtgttgttc
gaatgctcgggcgcggcaccagccttgatcgcggcgatccccgcgatgcgccccggcggg
atcatcatgcaactgggtctgggcggcgacatgaccctgccggtgcaggcgctcaccgcc
aaggaattgcaactgcgcgggtcgttccgctttcacgaagagttctttaccgccgtggat
ctgatgcggtcggggcggatcgacgtgaaaccgctgatcactcatgaggtaggtctggat
caggccgaagacggattcaaactggcctctgatcgaacccaggcaatgaaggcccaaatc
cggttttcatga

DBGET integrated database retrieval system