KEGG   Azospirillum humicireducens: A6A40_04990Help
Entry
A6A40_04990       CDS       T04409                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ahu  Azospirillum humicireducens
Brite
Enzymes [BR:ahu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A6A40_04990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ANC91313
UniProt: A0A160JEP8
LinkDB All DBs
Position
complement(1110103..1110696)
Genome map
AA seq 197 aa AA seqDB search
MAFELPPLPYAYDALAPYISSETLHLHHDKHHQTYVTNLNNLTKDTPLADASLEEVIKAS
AGDASKVGIFNNAAQVWNHTFFWQCLKKDGGKMPAALEQRIVADFGSVEKFKEELTQAAL
TQFGSGWAWLYLDGDKLKIGKTGNADTPLAHGHKPLFTIDVWEHAYYVDFQNRRADFVKA
VIDNLANWDFAAEQLAA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgaacttccgccgcttccgtatgcgtacgacgctctggctccgtacatctcg
tcggagactctgcacctgcaccacgacaagcaccaccagacctatgtcaccaacctgaac
aacctgaccaaggacaccccgctggccgacgccagcctggaggaggtcatcaaggcttcg
gccggcgacgcgtccaaggtcggcatcttcaacaacgccgcccaggtgtggaaccacacc
ttcttctggcagtgcctgaagaaggacggcggcaagatgccggcggccctggagcagcgc
atcgtcgccgacttcggcagcgtcgagaagttcaaggaagagctgacgcaggccgccctg
acccagttcggttccggctgggcctggctgtacctggacggcgacaagctgaagatcggc
aagaccggcaacgccgacaccccgctggcgcacggccacaagccgctgttcaccatcgac
gtgtgggagcatgcctactatgtcgacttccagaaccgccgcgccgacttcgtgaaggcc
gtcatcgacaacctcgccaactgggacttcgccgccgagcagctggccgcgtga

DBGET integrated database retrieval system