KEGG   Azospirillum humicireducens: A6A40_08760Help
Entry
A6A40_08760       CDS       T04409                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ahu  Azospirillum humicireducens
Pathway
ahu00061  Fatty acid biosynthesis
ahu00780  Biotin metabolism
ahu01100  Metabolic pathways
ahu01130  Biosynthesis of antibiotics
ahu01212  Fatty acid metabolism
Module
ahu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ahu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A6A40_08760
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A6A40_08760
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    A6A40_08760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ahu01004]
    A6A40_08760
Enzymes [BR:ahu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     A6A40_08760
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     A6A40_08760
Lipid biosynthesis proteins [BR:ahu01004]
 Fatty acid synthase
  Component type
   A6A40_08760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ANC91989
UniProt: A0A160JGB4
LinkDB All DBs
Position
complement(1903379..1904164)
Genome map
AA seq 261 aa AA seqDB search
MTTIIPAAATLEGKKGLVLGIANDQSIAWGCARAFRALGADLAVSYLNDKAKRFVEPLAQ
QLEAEIFEPVDVTGEGQLKAMFDKIGEKWGKLDFALHSIAFAPKEDLHGRVVDCSREGFQ
QAMDVSCHSFIRMAKYAEPLMKDGGSLFTMSYFGANRVIDNYGVMGPVKAALEASVRYLA
AELGPKGIRVHAISPGPIKTRAASGIAHFDELMDKAAERAPEGRLVTIEEVGYTTAFLAT
DGAKGITGDTTYVDCGYSIIG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgatcattcccgccgccgccacgcttgaaggcaagaaggggctcgtccttggc
atcgccaacgaccagtcgatcgcctggggctgcgcccgcgccttccgcgcgctgggcgcc
gacctcgcggtcagctatctgaacgacaaggccaagcgcttcgtcgagccgctggcccag
caactggaagccgagatcttcgaaccggtggacgtcaccggcgaaggccagctgaaggcc
atgttcgacaagatcggcgaaaagtggggcaagctggacttcgcgctgcacagcatcgcc
ttcgcaccgaaggaggatctgcacggccgcgtcgtcgattgctcgcgcgagggcttccag
caggcgatggacgtctcctgccattccttcatccgcatggccaagtatgcggagccgctg
atgaaggacggcggctcgctgttcaccatgtcctatttcggcgccaaccgcgtcatcgac
aattacggcgtcatgggtccggtcaaggccgcgctggaagccagcgtgcgctatctggcg
gctgaactcggcccgaagggcatccgtgtccacgccatctcccccggcccgatcaagacc
cgcgccgcctccggcatcgcccatttcgacgagctgatggacaaggccgccgagcgcgcg
ccggaaggccgtctggtgaccatcgaggaggtcggctacaccacggccttcctcgccacc
gacggcgccaagggcatcaccggcgacaccacctatgtcgattgcggttattccatcatc
ggctga

DBGET integrated database retrieval system