KEGG   Aeromonas hydrophila ML09-119: AHML_10405Help
Entry
AHML_10405        CDS       T02683                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
ahy00020  Citrate cycle (TCA cycle)
ahy00190  Oxidative phosphorylation
ahy00650  Butanoate metabolism
ahy01100  Metabolic pathways
ahy01110  Biosynthesis of secondary metabolites
ahy01120  Microbial metabolism in diverse environments
ahy01130  Biosynthesis of antibiotics
ahy01200  Carbon metabolism
Module
ahy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ahy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ahy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ahy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AHML_10405 (sdhA)
   00650 Butanoate metabolism
    AHML_10405 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AHML_10405 (sdhA)
Enzymes [BR:ahy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AHML_10405 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AHML_10405 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like DAO FAD_binding_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AGM43863
LinkDB All DBs
Position
2283022..2284788
Genome map
AA seq 588 aa AA seqDB search
MTIPTREFDAVVIGAGGAGMRAALQIAQSGKSCALLSKVFPTRSHTVSAQGGITVALGNA
HDDNWQWHMYDTVKGSDYIGDQEAIEYMCKTGPEAVYELENMGLPFSRFDNGTVYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNVKNKTTVFSEWYALDLVKNQDGHIVGC
TAIDMESGEVVYFKAKATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVGVQDMEFWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHIKLKLDHLGKEVLESRLPGICELSRTFAHVDPVKEPIPIIPTCHYMMGGV
PTNVNGQCLTQDKDGNDVPVVGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGMHLV
NTLSEMEHGRAASDADIDAALSRFNRWENCRDGEDPVQIRKDLQRCMQNNFSVFREGDAM
AEGLAELKLIRERLKNARLDDTSKEFNTQRIECLELDNLMETAYATAVAANFRTESRGAH
SRFDFPERDDESWLCHSLYHPDTESMTRRAVNMSPKTREAFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgactattccaactcgtgaatttgatgcggtggtgatcggtgccggtggcgccggcatg
cgcgccgcgctgcagattgcccaatccggcaagagctgcgctctgttatccaaggtattc
ccgacccgttctcacacggtttctgcccagggcgggatcacggttgcgctgggcaatgcc
cacgacgacaactggcagtggcacatgtacgacaccgtcaagggctccgattacatcggt
gatcaggaagccattgaatatatgtgcaagaccggccccgaggccgtctatgaactggag
aacatgggcctgcccttctcccgcttcgacaacggtaccgtctatcagcgtccgtttggt
ggccagtccaagaatttcggtggcgagcaggcggcccgtaccgcggcggcagccgaccgt
accggtcacgccctgttgcacaccctctatcagcaaaacgtcaagaacaagaccaccgtc
ttctccgagtggtatgcgctggatctggtgaagaaccaggacggccacatcgttggctgt
accgccatcgacatggagagcggtgaagttgtctacttcaaggccaaggccaccgtactc
gctaccggcggtgccggtcgcatctaccagtccaccaccaacgcccacatcaacaccggt
gatggcgttggcatggcgctgcgcgccggggtcggcgtgcaggacatggagttctggcag
ttccacccgaccggcatcgccggggcaggggtgctggtgaccgaaggttgccgcggtgaa
ggcggttacctgctcaataaagacggcgagcgcttcatggagcgttatgcgccgaacgcc
aaggatctggccggtcgcgacgtggtggcccgttccataatgatcgagatccgcgaaggt
cgtggctgtgacggtccctggggcccgcacatcaagctcaagctggatcacctcggcaaa
gaggtgctggaatcccgcctgccgggcatctgcgagctctctcgcaccttcgcccacgtg
gatccggtcaaagagccgattccgattatcccgacctgccactacatgatgggcggcgtg
ccgaccaacgtgaacggccagtgcctgacccaggacaaggacggcaacgacgtgccggtg
gtcggtctgtttgcggtgggcgaaatcgcctgcgtctcggtgcacggtgccaaccgtctg
ggcggcaactcgctgctggatctggtggtatttggccgcgccgccggcatgcacctggtc
aacaccctgagcgagatggagcacggccgcgccgcctccgacgccgatatcgacgccgca
ctgtcccgcttcaatcgctgggaaaattgccgcgacggtgaagatccggtgcagatccgc
aaggacctgcagcgctgcatgcagaacaacttctccgtattccgggaaggcgatgccatg
gccgaagggctggccgagctgaaactcatccgcgagcgcctcaagaacgcccgtctggac
gacacctccaaggagttcaacacccagcgcatcgagtgcctggagctggacaacctgatg
gagacggcctatgccaccgcggtggctgccaacttccgtaccgagagccggggcgcccac
agccgcttcgatttcccggagcgtgacgatgagagctggctgtgccacagcctctatcat
ccggacaccgagtccatgacccgtcgcgctgtcaacatgtcacccaagacccgtgaggcg
ttcccgcccaaggtccggacttactga

DBGET integrated database retrieval system