KEGG   Aeromonas hydrophila ML09-119: AHML_10410Help
Entry
AHML_10410        CDS       T02683                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
ahy00020  Citrate cycle (TCA cycle)
ahy00190  Oxidative phosphorylation
ahy00650  Butanoate metabolism
ahy01100  Metabolic pathways
ahy01110  Biosynthesis of secondary metabolites
ahy01120  Microbial metabolism in diverse environments
ahy01130  Biosynthesis of antibiotics
ahy01200  Carbon metabolism
Module
ahy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ahy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ahy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ahy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AHML_10410
   00650 Butanoate metabolism
    AHML_10410
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AHML_10410
Enzymes [BR:ahy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AHML_10410
    1.3.5.4  fumarate reductase (quinol)
     AHML_10410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: AGM43864
LinkDB All DBs
Position
2284805..2285521
Genome map
AA seq 238 aa AA seqDB search
MNVTFSVYRYNPDVDNVPHMKEYRLDIPEGSDMMVLDALIQLKELDPTLAFRRSCREGVC
GSDGLNMNGKNGLACITPLSDLLKKGNNVVIRPLPGLPVIRDLVIDMTQFYTQWEKVKPF
LINDEKLPPVREHLQSPEERAKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
WLADSRDTAATDRLGNLDDAFSVFRCHGIMNCVNVCPKGLNPTKAIGQIKSMLLNRAV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcacattctctgtctacagatacaatccggatgttgataacgtccctcatatg
aaggaatatcgtcttgatattcctgaaggttccgacatgatggtgctcgacgcactgatc
cagctcaaagagctggatcccacgctcgccttccgccgctcttgccgcgaaggggtctgt
ggatctgacggtctcaacatgaatggcaagaacggtcttgcctgcatcaccccgctctcc
gatctgctgaagaagggcaataacgtcgttatccgccccttgccaggcctgccggtgatc
cgtgatctggtgatcgacatgacccagttctacacccagtgggagaaggtcaaacccttc
ctcatcaacgacgaaaaattgccgcccgtgcgtgagcacctgcaatcccccgaagagcgc
gccaagctggatggcctgtacgagtgtattctctgtgcctgctgctccacctcttgcccc
tccttctggtggaacccggacaagttcatcggcccggccggtctgctcgccgcctatcgc
tggctggcggacagccgcgataccgctgctaccgatcgactgggtaatctggatgacgcc
ttcagcgtgttccgttgccacggcatcatgaactgcgtgaacgtctgtcccaagggcttg
aacccgaccaaggccatcggtcagatcaagtcgatgctgctcaatcgggctgtttag

DBGET integrated database retrieval system