KEGG   Aeromonas hydrophila ML09-119: AHML_10940Help
Entry
AHML_10940        CDS       T02683                                 

Definition
(GenBank) SM-20 domain-containing protein
  KO
K07394  SM-20-related protein
Organism
ahy  Aeromonas hydrophila ML09-119
Brite
KEGG Orthology (KO) [BR:ahy00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    AHML_10940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4 2OG-FeII_Oxy 2OG-FeII_Oxy_5
Motif
Other DBs
NCBI-ProteinID: AGM43970
LinkDB All DBs
Position
2427370..2427978
Genome map
AA seq 202 aa AA seqDB search
MDYQAVMDAIYTRGWVIVDDFLTAAEVDALKACLPDAWRPAGIGRDALHQDNRAIRRDQI
HWLEPSLGAPVADYLARMEALRLAANRMLMLGLFDYEAHFARYRSGDFYATHRDAFAGRS
NRRLTSVFYLNNDWQPQAGGVLRMYDDDEQFLMDVSPRGGRLVLFLSEEFPHEVLPANQE
RYSIAGWFRVNGSGNGRLDPPR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttggactatcaagccgtcatggatgccatttacacccggggatgggtgatagtggatgat
tttttaaccgccgccgaggtggatgccctcaaggcgtgcttgccggatgcgtggcggccg
gcggggatcggccgcgatgccctgcatcaggacaatcgcgccattcgccgggaccagatc
cactggctcgaaccctccctcggtgcgccggtggccgactatctggctcgcatggaggcg
ctgcggctggccgccaaccggatgctgatgctggggttgttcgactacgaggcccacttt
gcccgctatcgcagcggtgacttctatgccacccatcgcgacgccttcgccgggcgctcc
aaccgccgcctcacctcggtgttctacctcaacaacgactggcaaccccaggcgggcggg
gtactgcggatgtacgatgacgacgagcagtttttgatggatgtctcgccccggggcggg
cggctggtgctgtttttatccgaagagttcccccacgaggtgttgcccgccaaccaggag
cgctacagcatcgccggctggtttcgggtcaacggcagcggcaacggccggctcgatccg
ccgcgctga

DBGET integrated database retrieval system