KEGG   Aeromonas hydrophila ML09-119: AHML_10965Help
Entry
AHML_10965        CDS       T02683                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
ahy  Aeromonas hydrophila ML09-119
Brite
KEGG Orthology (KO) [BR:ahy00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    AHML_10965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AGM43975
LinkDB All DBs
Position
2430940..2431713
Genome map
AA seq 257 aa AA seqDB search
MELFTLLALFGVALVAGFIDAIAGGGGLLTVPALLATGMPPALVLGTNKLQSSFGSFSAT
WFYARKGLLEWHIIWPAVICTFIGAALGTLAVQTIDAAILERLLPFLLMAFACYFFFSPR
VSDAESSRRLAPMAFALLVGGGVGFYDGFFGPGTGSFFAIGFVALAGFGMARATAHTKLL
NFTSNIASLLFFALGGKVVWSVGFCMALGQFIGARFGSKMVLKQGVKLIKPLLVTVSLLM
SAKLVWSQYPELFAWLG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttggaactgtttaccctgcttgccctgttcggcgtggccctggtggccggctttatcgat
gccattgccggcgggggcggcctgctgacggtacccgccctgctcgccaccggcatgccg
ccggcgctggtgctcggcaccaacaagctgcagagcagttttggctccttctccgccacc
tggttctatgcccgcaaggggctgctggagtggcacatcatctggccggcggtgatctgc
accttcatcggcgcggcactcggcaccctggcggtgcagaccatcgacgccgccatcctg
gagcggttgctgcccttcctgctgatggccttcgcctgctacttcttcttctccccccgg
gtgagcgatgccgagagctctcgccgcctcgctcccatggcgttcgccctgctggtgggc
ggcggggtgggtttctatgacggcttcttcggaccgggcacaggatcgttttttgccatc
ggtttcgtggcgctggcaggctttggcatggcgcgggccaccgcccacaccaagttgctc
aacttcacctccaacatcgcctcgctgctgtttttcgcgctggggggcaaggtggtgtgg
agcgttggcttctgcatggcgctgggccagttcatcggcgcccgtttcggctcgaaaatg
gtgctcaagcaaggggtcaagctgatcaagccgctgctggtgaccgtctccttgctgatg
tccgccaagctggtgtggagccagtaccccgagctgtttgcctggctggggtaa

DBGET integrated database retrieval system