KEGG   Aeromonas hydrophila ML09-119: AHML_16190Help
Entry
AHML_16190        CDS       T02683                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
ahy00250  Alanine, aspartate and glutamate metabolism
ahy00280  Valine, leucine and isoleucine degradation
ahy00410  beta-Alanine metabolism
ahy00640  Propanoate metabolism
ahy00650  Butanoate metabolism
ahy01100  Metabolic pathways
ahy01120  Microbial metabolism in diverse environments
Module
ahy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ahy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AHML_16190
   00650 Butanoate metabolism
    AHML_16190
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHML_16190
   00280 Valine, leucine and isoleucine degradation
    AHML_16190
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AHML_16190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ahy01007]
    AHML_16190
Enzymes [BR:ahy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AHML_16190
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AHML_16190
Amino acid related enzymes [BR:ahy01007]
 Aminotransferase (transaminase)
  Class III
   AHML_16190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGM45006
LinkDB All DBs
Position
3664937..3666226
Genome map
AA seq 429 aa AA seqDB search
MSQSASNKAWQARREAAVVNGVGTLLPVFIERAQNAELWDVEGNRYIDFASGIAVLNTGH
NHPKVVAAVRAQLEKFSHTCFQVTPYPGYIELAEKLNALVPGPTPKRTLFLSTGAEAVEN
AIKIARAHTGRSGTIAFKGGFHGRTMMGMALTGKVVPYKTGFGPFPGEVYHLPFPSDYLG
VSEADALAALDLCFSSDIEPTRVAAIIIEPVQGEGGFYPASASFMQRLRSICDQHGILLI
CDEIQSGFCRTGKTFATEYAGIEPDIMTLAKSLAGGFPLSAVVGKAEVMNAAKPGGLGGT
YAGSPIACAAALAVLEVIEEEQLNQRAQAQGEQIKARLQQLAERFDCIGDIRGPGAMVAM
ELVKQRDAASPDADLTKRLVAEAGKRGLVLLACGVRANVIRFLAPLTASPALVDEGLDLL
EQALLAAQG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtcagcatcaaacaaggcgtggcaagcgcgccgtgaagcggccgtggtcaac
ggcgtcggcaccctgctgccggtgtttatcgagcgggcgcaaaatgccgagctgtgggat
gtggagggcaaccgctacatcgattttgcttccggcatcgccgtgctcaacaccggccac
aaccacccgaaagtggtggcggcggtacgcgcgcagctggaaaaattcagccacacctgc
ttccaggtcaccccctaccccggctatatcgagctggcggaaaaattgaatgccctggtg
cccggccccaccccgaagcgcaccctgtttctctccaccggtgccgaggcggtggagaac
gccatcaagatcgcccgcgcccacaccggtcgcagcggcaccatagccttcaaggggggc
tttcacggccgcaccatgatggggatggcgctcaccggcaaggtggtaccctacaagacc
ggcttcggccccttcccgggagaggtctatcacctgcccttcccgagcgactatctgggg
gtgagcgaggccgatgcgctggccgcgctggatctctgcttcagctcggatatcgagccg
acccgggtcgccgccatcatcatcgagccggtgcagggtgaagggggcttctaccccgcc
tccgccagcttcatgcagcgcctgcgcagcatctgcgatcagcacggcatcctgctcatc
tgcgacgagatccagagcggtttctgtcgcaccggcaagaccttcgccaccgaatatgcc
ggcatcgagccggacatcatgaccctggccaagagcctggccggcggcttcccgctctcc
gccgtggtgggcaaggcggaggtgatgaacgccgccaagccgggtgggctgggcggcacc
tatgccggctcccccatcgcctgcgccgccgccctggcggtgctggaggtgatcgaagag
gaacagctcaaccaacgggcccaggctcagggcgaacagatcaaggcgcgcctgcaacag
ctggcggagcgctttgactgcatcggcgacatccgcggccccggcgccatggtggccatg
gagctggtcaaacagcgcgatgcggccagcccggatgccgacctcaccaagcggctggtg
gccgaggcgggcaagcgtgggctggtgctgctggcctgcggtgtgcgtgccaacgtcatc
cgcttcctggcgccgctgacggcctcgccggccctcgtcgacgaggggctggatctgctc
gagcaggccctgctggcagcccagggctga

DBGET integrated database retrieval system