KEGG   Aeromonas hydrophila ML09-119: AHML_17095Help
Entry
AHML_17095        CDS       T02683                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
ahy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ahy01100  Metabolic pathways
ahy01110  Biosynthesis of secondary metabolites
ahy01130  Biosynthesis of antibiotics
ahy01230  Biosynthesis of amino acids
Module
ahy_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ahy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AHML_17095 (aroK)
Enzymes [BR:ahy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AHML_17095 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 Cytidylate_kin dNK AAA_16 AAA_22 ABC_tran Thymidylate_kin AAA_24 AAA_28 AAA TsaE Ploopntkinase3 AAA_5 APS_kinase AAA_29 AAA_17 Guanylate_kin AAA_7 RsgA_GTPase AAA_PrkA RNA_helicase AAA_25 IstB_IS21 GTP_EFTU DUF2385
Motif
Other DBs
NCBI-ProteinID: AGM45187
LinkDB All DBs
Position
complement(3891861..3892379)
Genome map
AA seq 172 aa AA seqDB search
MAEKRNIFLIGPMGAGKSTIGRHLAEQLHMEFFDSDHEIERRSGADIGWVFDVEGEEGFR
IREEKVIGDLSEQQGIVLATGGGAIKSRETRNKLSARGIVVYLETTIEKQLARTQRDKRR
PLLQTEEPPREVLERLAQERNALYEEVADFVIQTDDQSAKVVANQIVKLIGM
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaacgcaatattttcctgataggtcccatgggtgcgggcaagagcaccata
ggtagacatctggcagaacaactgcatatggagtttttcgactcagatcatgagattgag
cgccgcagtggtgccgatatcggctgggtgttcgatgttgaaggcgaagagggtttccgg
atccgcgaagagaaggtcatcggtgacctttccgaacagcagggtatcgtgctggcgacg
ggtggcggtgccatcaagagccgtgaaacacgcaacaagctctctgctcgcggcatcgtg
gtgtacctcgaaaccaccattgagaagcaactggcacgtacgcaaagagacaagcgtcgc
cccttgctgcaaaccgaagagccgccgcgcgaagtactcgagcgtctggcacaagaacgc
aacgccctgtatgaagaagtggctgactttgtcatccagactgatgaccagagcgctaaa
gttgttgccaatcaaatcgttaagttgatcggcatgtaa

DBGET integrated database retrieval system