KEGG   Aeromonas hydrophila ML09-119: AHML_22080Help
Entry
AHML_22080        CDS       T02683                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
ahy00260  Glycine, serine and threonine metabolism
ahy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AHML_22080 (tdh)
Enzymes [BR:ahy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     AHML_22080 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like Pyr_redox_3 FAD_binding_2 Pyr_redox_2 MTS Methyltransf_25 FAD_oxidored 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AGM46172
LinkDB All DBs
Position
4968512..4969540
Genome map
AA seq 342 aa AA seqDB search
MKALSKLHKEVGIWMTDVPAPELGHNDLLIKIRKTAICGTDIHIYNWDEWSQKTIPVPMV
VGHEYVGEVVAIGQEVRGFAVGDRVSGEGHITCGHCRNCRAGRTHLCRNTIGVGVNRPGA
FAEYLVIPAFNAFKLPDNVPDELAAIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIMAA
AVCRHVGARHVVITDVNEYRLELARKMGATRAVNVAKEQLSDVMSELGMTEGFDVGLEMS
GVPSAFQDMIDKMNHGGKIAMLGIPPATMAIDWGKVIFKGLFIKGIYGREMFETWYKMAS
LIQSGLDLSPIITHRFHIDDFQQGFDAMRSGQSGKVILSWDK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctctccaaactgcacaaagaagtcggcatctggatgacggacgtaccggcc
cccgaactcggccacaacgacctgctgatcaagatccgcaagaccgccatctgtggcacc
gacatccatatctacaactgggacgagtggtcacagaagaccatcccggtacccatggtg
gtcggccacgaatacgtcggggaagtggtcgccatcggccaggaagtgcgcggcttcgcg
gtcggagaccgggtatccggtgagggccacatcacctgtggccactgccgcaactgccgt
gccggccgcacccacctgtgccgcaacaccataggcgtcggcgtcaaccgccccggcgcc
ttcgctgagtatctggtgatcccggccttcaacgccttcaagctgccggacaacgtcccc
gatgaactggccgccatcttcgatccgttcggcaacgcggtgcacaccgccctctccttc
gacctggtcggtgaagacgtgctgatcaccggcgccggccccatcggcatcatggccgcc
gccgtctgccgccacgtgggagcccgccacgtggtgatcaccgacgtcaacgaataccgg
ctcgagctggcccgcaagatgggtgccactcgcgccgtcaacgtggccaaggagcagctc
agcgacgtgatgagtgaactcggcatgaccgaagggttcgacgtggggctggagatgtcc
ggcgtgcccagcgccttccaggacatgatcgacaagatgaaccacggcggcaaaatcgcc
atgctcggcatcccccccgctaccatggccatcgactggggcaaggtgatcttcaaggga
ctgtttatcaaagggatctacggtcgtgaaatgttcgagacctggtacaagatggccagc
ctgatccagtccgggctggatctctcccccatcatcacccaccgcttccacatcgacgac
ttccagcaagggttcgatgccatgcgttcaggccagtccggcaaggtgatcctcagctgg
gacaaataa

DBGET integrated database retrieval system