KEGG   Algibacter alginolytica: APS56_01850Help
Entry
APS56_01850       CDS       T04100                                 

Definition
(GenBank) restriction endonuclease
Organism
ahz  Algibacter alginolytica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII DUF2135
Motif
Other DBs
NCBI-ProteinID: ALJ03970
UniProt: A0A0P0CDH6
LinkDB All DBs
Position
468251..469090
Genome map
AA seq 279 aa AA seqDB search
MQKQFDDFLNELSETNATLDYYTDFDKIITNVNKISLKLNQLNYLIGKDDLKTAISEVFN
ENPKAFEVLGILIAVRKKDKKKTIDLNGDVVLVQSYFNDANKVFEFIEETGLGGVFRNKN
ITNLVDYVFGVEVGLDSNARKNRGGSNMEKAVSKIFQKHNIFHKKEVYLTDYPEILSLGG
DLKRVDFIIKTSVKTYLIEVNYYNGGGSKLNETARSYSDLAPKINQYDNFEFVWITDGRG
WFSAKNKLQEAFNIIPSLYNLTSLDAFIKKVKEENPEVF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagcaatttgatgatttcttaaacgaattaagcgaaactaacgctactcttgat
tattatactgactttgataagattattacaaacgttaataagatttcattaaagttaaat
caacttaactatttgataggtaaagatgatttaaaaactgcaattagtgaagttttcaat
gaaaacccaaaagcttttgaagttctaggaatacttatagctgtaaggaaaaaggataag
aaaaaaacaattgatttgaatggagatgtagttttagttcaatcatattttaatgacgca
aataaagtttttgaatttatagaagaaacgggattaggaggtgtttttagaaataaaaat
atcacaaatttagttgattatgtttttggtgtagaagttggtttagacagcaatgcacgt
aagaatagaggtggaagtaatatggaaaaagcggtttccaaaatatttcaaaaacataat
atttttcataaaaaagaagtttatttaactgattatcctgaaatattaagtttaggaggt
gatttaaaaagagttgattttataattaaaacaagtgtaaaaacatacctgatagaagta
aattattataatggtggaggctctaaattaaacgagactgctagatcatattctgattta
gctccgaaaataaatcaatatgataactttgaatttgtatggattactgatggtcgaggt
tggttcagcgcaaaaaataaattacaagaagcatttaatattataccaagtttatacaac
cttacttcattagacgcattcatcaaaaaagtaaaagaagaaaacccagaagttttctga

DBGET integrated database retrieval system