KEGG   Algibacter alginicilyticus: APS56_04550Help
Entry
APS56_04550       CDS       T04100                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ahz  Algibacter alginicilyticus
Pathway
ahz00564  Glycerophospholipid metabolism
ahz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ahz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    APS56_04550
Enzymes [BR:ahz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     APS56_04550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 HI0933_like Thi4 GIDA Lycopene_cycl FAD_binding_3 Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ALJ04453
UniProt: A0A0P0CVK9
LinkDB All DBs
Position
complement(1085626..1087206)
Genome map
AA seq 526 aa AA seqDB search
MNLFDRTSLVETLKVNLEWDVIIIGGGATGLGVALDSVTRGYKTLLLEQVDFAKGTSSRS
TKLVHGGVRYLEQGNIDLVKEALYERGLMLKNASHLVSNQSFIIPNYRWWDIVFYTVGLK
IYDFLSGKLSFGKSLKISKKETLARLKTIKTENLKGGVAYHDGQFDDSRLAINIAQTCIE
YGATVINHFKVVQLLKSSDGSLNGVVAKDAETNQLHTLKTKLVINATGVFTDEVLKMDNV
SAKNIIRPSQGVHLVLDKSFLPGTDAIMIPKTADGRVLFLVPWHNRIIVGTTDTLLYSHS
LEPKALDEEIDFIIETANKYLTKKVTKSDVLSVFSGLRPLAAPKNKSEKTKEISRSHKII
VSKSGLITITGGKWTTYRRMAQDTINKAIRLGKLSKAKCITKDLKIHGSTMEMIGQSNHL
YVYGSDQKGINQLIGEFPELGEKLHPRLEFLKAEVIWAIRNEMARTVEDILARRVRALFL
DANAAIEITPLVAKMLAKELDKDEDWKHQQISDFIEVASHFIIKKY
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atcaatttgtttgataggacttctttagttgaaacgctaaaagtgaatttggagtgggat
gttattatcattggtggtggggctactggtttaggagtcgctttagatagtgtaacacgc
gggtataaaactttacttttagaacaagtagattttgcaaaaggtacctcaagccggagt
actaaattggtacatggaggtgtcaggtatttggagcaaggtaatattgatttggtaaaa
gaagcgttatatgaaagagggttgatgttaaaaaatgcatcacatttagtgagtaatcaa
tcgtttattataccaaattataggtggtgggatattgttttttataccgtaggattaaaa
atatacgattttttatcaggaaaactaagttttgggaaatcgttaaaaatttcaaaaaag
gaaactttagcacgtctaaaaaccataaaaacagaaaatcttaaaggaggggttgcttat
catgatgggcaatttgatgactccagattagcaattaatatcgctcagacttgtattgaa
tatggtgctacagtcatcaatcattttaaagtagttcagttgttaaagagcagcgatggt
agcttaaatggtgttgtcgcaaaagatgctgaaacaaaccagctacatactttaaaaaca
aaattggttattaatgccacaggtgtttttacagatgaagttttaaaaatggacaatgtg
tctgctaaaaatataatacgtccgagccaaggtgtgcatttggttttagataaatcattt
ttacctggaacggatgctattatgatccctaaaactgctgatgggagagttttattttta
gtgccttggcataatagaataattgtaggaactactgatacgcttttgtacagtcatagt
ttagaaccaaaagcattagatgaagaaattgattttataatagaaacagctaataagtat
ttaacaaaaaaagtaactaaaagtgatgttttgagtgttttttcaggattaagaccttta
gcagctcctaaaaataaatcagaaaaaacaaaagaaatatccagaagtcataaaattatt
gtctcaaaatcagggttgattactattactggcggaaaatggacaacctacagacgtatg
gctcaagataccataaataaagctattaggttaggtaaactgtcaaaagctaaatgtata
acaaaagacttaaaaattcatggatctactatggagatgatagggcaatcaaatcatttg
tatgtttatggtagtgaccaaaaaggaataaatcaactaattggagaatttccagaatta
ggagaaaaattacatccaaggctggagttcttaaaggcggaagttatttgggcaattcga
aatgaaatggctagaactgttgaagatatcttagcaagacgtgtaagggccttgtttttg
gatgctaatgcagcaattgaaatcacccctttagtagctaagatgcttgctaaagaatta
gataaagatgaagattggaaacatcaacaaatttctgattttatagaagttgccagtcat
tttattataaaaaaatattag

DBGET integrated database retrieval system