KEGG   Algibacter alginicilyticus: APS56_11255Help
Entry
APS56_11255       CDS       T04100                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ahz  Algibacter alginicilyticus
Pathway
ahz00240  Pyrimidine metabolism
ahz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    APS56_11255
Enzymes [BR:ahz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     APS56_11255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ALJ05668
UniProt: A0A0P0CME5
LinkDB All DBs
Position
complement(2715630..2716277)
Genome map
AA seq 215 aa AA seqDB search
MFLENTVNHKEQFGWVEVICGSMFSGKTEELIRRLKRAQFARQRVEIFKPAIDVRYNEDM
VVSHDSNEIRSTPVPAAANIPILADGCDVVGIDEAQFFDDEIVRVCNDLANKGVRVIVAG
LDMDFKGNPFGPMPNLMATADYVTKVHAICTRTGNLAQYSYRKAKSDNLVLLGEVDEYEP
LSRAAFYKAMTRDKVRNMKVNDAEEITPKSKNKDA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacagtaaatcataaagaacaatttggttgggttgaagtgatttgc
ggttccatgttctcgggaaaaaccgaagaattaatccgtagattaaaacgcgcacaattt
gccagacagagagttgaaatctttaaaccagctattgatgtgcgttataatgaagatatg
gttgtatcgcacgactccaacgaaatccgctctactccagttcctgccgcagcaaacatc
cctattttagctgatggctgtgatgttgttggcatagatgaagcccaattttttgatgat
gaaatagtgcgtgtttgtaacgatttagcaaataaaggtgttagagttattgttgcagga
ttggacatggattttaaaggtaacccttttggtccaatgcccaacttaatggcaacagcc
gattatgtaactaaagtacatgctatttgcacacgaacaggaaacttagcccaatacagt
taccgaaaagccaaaagtgataatttagtgcttttaggagaggtagatgaatacgaacct
ttaagcagagccgctttttataaagctatgacacgagacaaagttagaaacatgaaggta
aacgatgctgaagaaataacccctaaatccaaaaacaaagatgcctaa

DBGET integrated database retrieval system