KEGG   Algibacter alginicilyticus: APS56_12520
Entry
APS56_12520       CDS       T04100                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
ahz  Algibacter alginicilyticus
Pathway
ahz00620  Pyruvate metabolism
ahz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APS56_12520
Enzymes [BR:ahz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     APS56_12520
SSDB
Motif
Pfam: F5_F8_type_C
Other DBs
NCBI-ProteinID: ALJ05903
UniProt: A0A0P0DD11
LinkDB
Position
complement(3019378..3022851)
AA seq 1157 aa
METKMTNDTISQSRKDTVQYINLQLASLGQPLFQDNEDDAEKFCNPKLQQLTSAFTKGFK
EKSRLLSKYLSPADTRIQNFINDYLKDVTLNKSYEIPNDTLVLNQKGHAREISLPPNGTS
FKSDDIVSHRIKQGILNNPVNDKRTTKGTFHIVEGPLPVPLDKKEVPKIAFAHFLNAAFS
PPDALKTLPFTANQKDKAKVFVSLLLRPMVCPEVTGVISKKSMEVRFFAPGSLVSNLDFV
ESIFGNAGDPNLAHNDAALDTEHWTGHTGCIILAPHLKTLKKKDVGLPHWNDATERQKND
GMCWKNEDEIYNDGGAFKVTCRDDRGVVVTIIADNYFGYSKKEIKTQISYSANLFGLVEE
EHSGGAIAYPRGVMGDIVDGNGFSKRYGNKFSFEEVKTLLGERIDVKPENYAVDKKYPNL
IYVPENAYINTNTNSITWKYNNKEQKLTLSPTKTYIHPTGNKFKLEKHKAISLWRIVNTS
PEGVFCHKPCTVSGGGKSEISKSMLNAITYSTFNVLNIDEDFKKADEIIEYDYSKRWKNY
DPSLPPSETFLSPKRTLGSAVRLLQPLDDFSDEYNTFVKNIPVHIRSLVLFVKRLYRQDH
DTLNWKECVSVDIINGQKGTGLNYFNNPVVGSYVRIGFNQEGRWLLNKLRSDFSASQKIQ
MEDDISASITLPKNQFKNLNPDLKNGSFKVVANCESYLFQRPDEAIIRGYDEGAERDIVT
DNTFLTNYELLTKKDAIEIYEDTINFDKYTQPVKDLIISIVNSPKDEDYFCLPSHTRIVN
GEPTKNPRYLEKNIFIDETEASYLGEVGVRLYRKIKSEDPVIHVVNAVLPGRRNNPVDKK
NGIRPLAVYNPIHYQEAPEMFMDFICSLTGKSPSTTGAGSEGALTKGPFNMLTPTTDLNN
ALLSHILTDSNAFSTAAGYVGAENKVDHDISLLIPEIWARLDEKDRNPKLLIEDGCLEKI
EDFEYKGKKVLASRLGYRITSRFSLRCLNKLFDEPVAVFNERMLKPELQGMEDYVDGIAN
IVEAQQKVALRYFEDGSIDSAIPPIKILLHIMAYGTYEGKDISHPELRQYFDRDYIINSD
WYKDRLKLKQAKDLHFYNSQINYLETFIENPNNADLVSEMKIKDQLKTVKQKYNEVKTDE
YFNSLIGTIGADPLFRK
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggaaacaaaaatgactaacgatacgatttcacaaagtagaaaagatacagttcagtat
ataaatctgcaattggcctctttaggacaaccactttttcaagataatgaagatgatgct
gaaaaattttgtaatccaaagcttcaacaattgacgagtgctttcactaagggctttaaa
gaaaaatctcgtttgttatcaaaatatctatctccagctgacacaagaattcaaaatttc
ataaatgattatttaaaagatgttacccttaataaatcttacgaaatccctaatgatact
ttggttttaaatcaaaaagggcatgccagagaaattagtttacctcctaatggcacctct
tttaaaagtgatgacattgtttctcataggataaaacaaggtattttaaacaatcccgtt
aatgacaaaagaactacaaaaggcacatttcatattgtagaaggacctttacctgtacca
ttagacaaaaaggaagttcctaaaatagcatttgctcattttttaaatgcagcttttagt
ccaccagatgctttaaaaacactgccttttactgccaaccaaaaagataaagcaaaagta
tttgtatccctattattacgcccaatggtttgcccagaagtaacaggtgtaatttccaaa
aaaagtatggaagtccgcttttttgctccaggaagtctggtaagtaatttagattttgtt
gaatctatttttggaaatgcaggtgatccaaatttagcccataatgatgctgcattagat
acagaacactggacagggcatactggctgtattatattagctccacatttaaaaacactt
aagaaaaaagatgttggcttaccacattggaatgatgccactgaacgtcaaaaaaatgac
ggcatgtgttggaaaaatgaagatgaaatttacaatgacggtggtgcttttaaagtaacc
tgtagagacgaccgaggtgtggttgtaacaattattgccgacaactattttggttattcc
aaaaaagaaataaaaactcaaattagttattctgctaatttatttgggttggttgaagaa
gaacactcaggtggagctatagcctacccaagaggagttatgggtgacattgtagatggt
aatggtttttcaaaacgatatggaaataaattttctttcgaggaagttaaaacactatta
ggagaacgaattgatgttaaacctgaaaactatgccgttgataaaaaatatccaaattta
atttacgttccagaaaatgcttatataaatacaaatacaaatagtattacttggaaatat
aacaacaaagaacagaaattaactttatctcctaccaaaacatacatccacccaacggga
aataaatttaaattagaaaaacacaaggctatttcgttatggcgtattgtaaacacctca
cccgaaggtgtcttttgccataaaccatgtacagtttccggaggtggaaaatctgaaatt
tcaaaatcaatgttaaatgctattacttatagtacatttaatgttttaaatattgatgaa
gattttaaaaaagcagatgaaatcattgaatacgattattcaaaacgttggaaaaattac
gatccaagtttacccccatcagaaacttttttgagtcctaaacgaaccttagggtctgcc
gtaagactattacaacctttagacgattttagtgatgaatacaacacatttgtcaaaaac
atacctgttcatattcgctctttggtattgtttgtaaaacgattataccgtcaagaccac
gatactctaaattggaaagaatgtgtttctgttgacattattaatgggcaaaaaggaaca
ggccttaattatttcaataatccagttgttggtagttatgtccgtattggatttaatcaa
gaaggccgttggttattaaacaaattaagatctgatttttctgcaagtcaaaaaattcaa
atggaagacgatatctcagcatctataaccctacctaaaaatcaatttaaaaatttaaat
ccagatttaaaaaatggaagttttaaagttgtagcaaactgtgagagctatttatttcaa
cgcccagacgaggccattattagaggctatgacgaaggcgccgaacgcgatatcgttaca
gacaacacctttttaactaattacgaacttttaacaaaaaaggatgctattgaaatttat
gaagacactattaattttgataaatatacccaacctgttaaggatttaattattagcatt
gttaacagtccaaaggatgaagactatttttgcttaccatcacacacaagaattgtaaat
ggcgagccaacaaaaaatccaagatatttagaaaaaaacatttttattgatgaaaccgaa
gctagttatttaggagaggttggcgttcgtttatacagaaaaattaaatctgaggacccc
gttattcatgtggttaatgcggttttaccaggtcgtagaaataatcccgtggataaaaag
aacggcatacgcccattagctgtttacaaccctattcactatcaggaagcaccagaaatg
tttatggattttatttgtagtcttactggtaaatcaccatctacaactggagcaggttct
gaaggtgctttaaccaaagggccttttaatatgttaacaccaacaaccgatttaaataat
gcattactatctcatattcttacagattcaaatgcattcagtacagctgctggttatgta
ggtgcagaaaataaagtagaccacgatataagtttattaatcccagagatttgggcgcgt
ttagatgaaaaagatcgcaaccctaaattactaatagaagatggttgccttgaaaaaata
gaagattttgaatataaaggcaaaaaagtattagcaagccgtttaggatacagaataaca
agtagattttccttaagatgcttgaacaaattatttgatgaacctgttgctgtttttaac
gaaagaatgttaaaaccagaattacaaggcatggaagattatgtagatgggattgccaat
attgttgaagctcagcaaaaagtagcccttcgttattttgaagatggtagtattgattca
gcaattcctccaataaaaatattattacacattatggcttatggcacttatgaaggcaaa
gatataagccatccagagttaagacaatattttgatagagattacataattaatagcgat
tggtataaagaccgattgaaattaaagcaagctaaagacctacacttttataattctcaa
ataaactatttagaaacatttattgaaaatccaaacaatgctgatttagtgtctgaaatg
aaaattaaagaccaattaaaaactgtaaaacaaaaatataatgaagtaaaaacggatgaa
tactttaatagtttaattggtactattggtgcagacccattgtttagaaaataa

DBGET integrated database retrieval system