KEGG   Acinetobacter indicus: CTZ23_05585Help
Entry
CTZ23_05585       CDS       T05342                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aid  Acinetobacter indicus
Brite
KEGG Orthology (KO) [BR:aid00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CTZ23_05585 (ahpF)
Enzymes [BR:aid01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CTZ23_05585 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 K_oxygenase FAD_binding_3 AlaDh_PNT_C NAD_binding_8 FMO-like Glutaredoxin Spermine_synth
Motif
Other DBs
NCBI-ProteinID: AVH13802
UniProt: A0A0F3LRB8
LinkDB All DBs
Position
complement(1142121..1143686)
Genome map
AA seq 521 aa AA seqDB search
MLDQNTTAQLKALLERLEGPIELVATLDASDKSDKIKELVTEIAALSDQVTARFDGNNKR
APSFGVAKAGEQPRVFFAGLPMGHEFTSLILALLQTSGYAPKVSDEVLASIKDLGIQSDF
DVFVSLSCHNCPDVVQALNLIAIYNPGTTATMIDGAFFQDEVEERKIMAVPMVFQDGNHI
GQGRMTLEEIIAKLDTNSAAKEAEKLNAKAAFDVLVIGGGPAGNTAAIYAARKGINTGIV
AERFGGQVMDTMDIENFTSIKKTQGPKFAAEMEAHVREYGVDIMNLQRVSDIKGADETAN
GLVEVTLENGAKLESKTVVLSTGARWREMNVPGEAEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQDKLNSLPNTTVIKNALSTEVVGD
GSQVTALKYKDRATDEEHTVELAGIFVQIGLLPNTDFLKDTQVELSNRGEIVINDRNETN
VKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaatactacagcccaattaaaagccttgttagaacgccttgaaggtcca
atcgaactggtggccactttagatgcttctgacaaatcagacaaaatcaaagaactggta
actgaaattgccgccctgtctgatcaggtgactgcacgctttgatggcaacaacaaacgt
gcaccaagctttggtgtagccaaagccggtgagcaaccgcgtgtattcttcgcaggttta
ccaatgggccatgagtttacctctttgattctggcattgttacaaacctcaggctatgca
ccaaaagtgtctgatgaagtgctggcttcaatcaaagacttaggcatccaatcggatttc
gatgtattcgtatcgttaagctgtcacaactgtccagacgtggtgcaggcattgaacctg
attgcgatctataaccccggcactactgctaccatgattgatggtgcattcttccaggat
gaagtggaagaacgtaagatcatggcggtaccgatggtgttccaggacggtaatcacatc
ggtcaggggcgtatgacgctggaagaaatcattgccaaattggataccaactctgcagcc
aaagaagctgaaaagttaaatgccaaagctgcctttgatgtcttggtgattggtggtggt
cctgccgggaacactgcagcgatttacgcagcacgtaaaggcattaacaccggtatcgtg
gcggaacgttttggtggtcaggtcatggacaccatggacattgagaactttacttcaatc
aagaaaacccaaggtccaaaattcgccgctgaaatggaagcacacgtacgtgaatacggt
gttgacatcatgaacctgcaacgtgtatctgacattaaaggtgcagatgaaacggctaac
ggtttagttgaagtgaccttggaaaacggtgccaaactggaatcgaaaactgtggtgctt
tcaaccggtgcacgctggagagagatgaacgttccaggtgaagcagaataccgtacccgc
ggtgtagcgtattgcccacactgtgatggtcctttgtttaaaggcaaacgtgttgcagtc
attggtgggggtaactccggtgtagaagcggccattgacctggcgggtattgttgagcat
gtgacgctggtggagtttgataccaaattacgtgccgaccaggtattgcaagacaagcta
aacagcttgccaaacaccactgtcatcaaaaatgcgctttcgacagaagtggtcggtgat
ggttcacaagtcactgcactgaaatacaaagaccgtgcaacggatgaagagcatacggtt
gaactggcagggatctttgtacagatcggtttattacccaataccgatttcttgaaagac
actcaagttgagctgagcaaccgtggcgagattgtgattaatgatcgcaacgaaaccaac
gtcaaaggtgtatttgctgctggtgactgtactacagtaccatacaagcagatcatcatt
gccacaggtgaaggcgcaaaagcatcgttgtctgcttttgattacattatccgttcgggg
caataa

DBGET integrated database retrieval system