KEGG   Acinetobacter indicus: CTZ23_09575Help
Entry
CTZ23_09575       CDS       T05342                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase PBP5/6
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
aid  Acinetobacter indicus
Pathway
aid00550  Peptidoglycan biosynthesis
aid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aid00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CTZ23_09575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aid01002]
    CTZ23_09575
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aid01011]
    CTZ23_09575
Enzymes [BR:aid01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CTZ23_09575
Peptidases [BR:aid01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   CTZ23_09575
Peptidoglycan biosynthesis and degradation proteins [BR:aid01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CTZ23_09575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AVH14510
UniProt: A0A2L2J3R7
LinkDB All DBs
Position
1971695..1972843
Genome map
AA seq 382 aa AA seqDB search
MTRKSALAALLLLPSFSYAATVLSNPPELNNKSYVLMDYETGQILASKNENEKLAPASMT
KMMTSFIIEQKLLKGELTEDEKVRMNESAWCRGSNTESCMYVPLNGTATVLEMLRGIIVQ
SGNDASKAMAEHIAGNEGTFAHMMNEEAKKIGMTNTQFINSTGMPADGHYSTAKDMATLA
QHIIKDSSKYYPLYSEKEFTFNGIRQGNRNALLYTDPSVDGLKTGHTNEAGYCLTTSAKR
GPTRLISVIFGAPTMQERATQTRELLAWGYANFETKNVQRANQVLAKSKVWFGQSDEVQI
GLAENFNVTMPKGKANEIKTQLVVQPKLTAPLQKGQVIGKYVASLDGKVIAEKPLVALNA
VEEAGFFSRLIDHIKQFFSNLF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgactcgaaaaagcgcccttgctgccttactcctcctaccaagcttttcttatgcagca
actgttttatccaatccgccagaactcaacaataaatcttatgttttaatggattatgaa
acagggcaaattcttgcatcgaaaaatgaaaatgaaaaacttgccccggcgtcaatgacc
aaaatgatgaccagtttcatcattgaacaaaaactattgaagggcgaactcacggaagat
gaaaaagttcgtatgaacgaatctgcatggtgtcgtggtagtaacacagaatcatgtatg
tatgttccgctgaatggcactgcaactgtacttgaaatgctgcgtggaattattgttcag
tcgggtaatgatgcctctaaagccatggcggaacatattgccggcaatgaaggcaccttc
gcgcacatgatgaacgaagaagccaaaaaaattggcatgaccaatacccagtttattaac
tcgactggtatgccagcagacggccattattcaactgccaaagatatggcaaccttggcc
cagcacatcattaaagacagttctaaatactatccgctttattcagaaaaagaatttacc
tttaatggcatccgtcaaggcaaccgtaatgccctgctctatacagacccaagtgttgat
ggtttaaaaaccggtcataccaatgaagccggctactgtttaacgacttctgcaaaacgt
ggcccaacgcgtctgatttctgtgatttttggtgcgccaaccatgcaggaacgtgcgaca
caaacacgtgaattgctggcttggggttatgccaactttgaaaccaaaaatgtacagcgt
gcaaatcaggttctggccaaatctaaagtctggtttggtcagtctgacgaagtacaaatt
ggtctggctgaaaactttaatgtgaccatgcctaaaggcaaagccaatgaaattaaaacg
caattggtggttcagccgaaattgactgcgccgctacaaaaaggccaggtcattggtaaa
tatgtcgcaagcctggatggtaaagtaattgcagaaaaaccactggtggctttaaacgcg
gttgaagaagctggtttcttctcacgcctcattgaccatatcaagcagttctttagtaac
ctgttctaa

DBGET integrated database retrieval system