KEGG   Acinetobacter indicus: CTZ23_11920Help
Entry
CTZ23_11920       CDS       T05342                                 

Definition
(GenBank) hypothetical protein
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
aid  Acinetobacter indicus
Brite
KEGG Orthology (KO) [BR:aid00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aid03400]
    CTZ23_11920
DNA repair and recombination proteins [BR:aid03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CTZ23_11920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SbcCD_C AAA_29 SMC_N AAA_21 DIT1_PvcA NTPase_1 MMR_HSR1 MeaB RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AVH14908
UniProt: A0A2L2J5E0
LinkDB All DBs
Position
2445657..2449262
Genome map
AA seq 1201 aa AA seqDB search
MKILRLSLNNLASIAGTQDINFESAPLAHAGLIAITGKTGAGKSTLLDAMCLALYDQIPR
LNGAAGALKDASGQGISIKDSKNILRRGCTQGFAELEFIALDQKRYLARWEVRRARNKVD
GNLKVERAITAVEDQRVLTQKISECTPTVEKLIGLSFEQFTRAVLLAQSEVGAFLKAKDQ
DRADLLEYLTNSHIFSLVSQKAFEKIRQIRSEKEQLQQLMGHIDLLSDEQLQILQQQHAQ
SKLSLHEKLQSEKLLLNDLSWYKQQHRLHSEIQAKKEFYLVQVDANQKMQPQRDLLAQLD
QFQEIREQYLQQRQQQLQQQQLAQQLEQFQPEYQHCEQQHLQAQQQLEQLQHSAQQQQKE
QLQLQPVLEQALQLDGQIEHLIQRYKEADTQLKQIQNEKITPLTTQQHGQQQHLQQLHMQ
LEHLEQQSVQHAFLAVFDREPHSILQRLQQFQKLQQQLQQQAPAHAYSSLAQLQQQLNDV
KQQQADALQQAGSLAELEQQATELEQQQVQHQQHSQQLEQALFLLQHMLSEQQEQQQLQQ
HITQLQAELSSLQQAQTEAQQHYQNAQTAREQLEQIFAQQRLLQAQSVQELRQQLQAEQP
CMVCGSTEHPFVSHQDLLESALQSVQDTQLQQAQQQEQQCQQQLQQLQLQHSKQQTLLEQ
KQLRSSQLQDSVQQKLQQVQTLSPSTQLDDTAHDLTALQTTLQHKLNQQQQQLQQLKTRQ
QQLKNQTQQLQHLQQQIQTLQLLCQQFQQLEQLIEPVTQALEPAQQAQWANQAEMCQTLI
ALLSSRTQYLQQREQCLQQQQELQRQIKDGEQQLQFYQQQQQQLSNDRTHAQTQGSQLRQ
QVRDLSQQHTGQVLDTGKAWQHLLREQQQQLQQQVEQQRLHCRQLEQQFQQAQLKQQGLH
TRQQQLLESVQQLQHNIQQWQSQHPQFTAEQIEQCLGIDLASWQAIRQAIQQQQQAMLSA
QSALDVLQEQFQQHQAQQPTTSYDEVTTQLEQLEQEKNSLQEQFNQLETQLRMQQQAQAQ
LSKFQSQIEKIQAEEYRWGRIADLIGSKEGTKFQKIAQEHHLDILVEHANQQLQPLAPRY
QLQRIPNSLGLAILDHDMNGEIRPVLSLSGGETFLVSLALALAIANMASGSMKLESLFID
EGFGTLDPASLHMVMNALDRLQSQGRKVVLISHIQEIHERIPVQIQVKPIGAGASTLQIV
G
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttacgtttaagtctgaacaatctggcttctattgccggcacccaagacatc
aactttgaaagcgcaccgctggcacatgccggcctgattgcgattaccggaaaaaccggg
gccggtaaatcgaccctgctcgatgccatgtgtctggcgctgtatgaccagattccgcgc
ttaaacggcgctgccggggcgcttaaagatgccagcggtcagggcatctcgattaaagat
tctaaaaatattctgcgccgcggctgtacccaaggctttgccgaactggaatttattgcg
ctggatcaaaagcgttatctggcacgctgggaagtgcgccgcgcccgtaacaaggtcgat
ggcaatttaaaagtcgaacgcgcgattactgctgtggaagatcagcgcgtgttgacccag
aaaatttcggaatgcaccccgaccgttgaaaagctgattgggctgagttttgagcagttt
acccgcgccgtcttgctggcccaatctgaagtgggtgcgtttttaaaggccaaagatcag
gaccgcgccgacttgctggaatatctgaccaattcccatattttcagcctggtcagtcag
aaagcctttgaaaaaatccgccagattcgtagcgaaaaagaacagttacaacagctgatg
gggcatattgatctgctcagtgatgaacagctgcaaatcctgcaacagcagcatgcccag
agcaaactgagtctgcatgagaaactgcaaagcgaaaaactgctgctgaatgatttaagc
tggtacaagcagcagcatcgtctgcacagtgaaattcaggctaaaaaagaattttatctg
gtccaggtcgatgccaaccagaaaatgcagccgcagcgtgacctgctggcgcagctggac
cagtttcaggaaatccgtgaacagtatctacagcagcgccagcaacagttgcaacagcaa
cagctggcgcagcaacttgagcaattccagccggaatatcaacactgtgaacagcaacac
ctgcaggcacagcagcagctggaacaattgcagcacagcgcgcaacaacagcagaaagaa
cagctacagttacaacccgtgttagaacaggcactacagctggatggccagattgagcat
ctgattcagcgctataaagaagccgatacccagctgaaacagattcaaaatgaaaaaatt
acaccactaaccacccagcagcacggccagcaacagcacttacagcagttgcatatgcag
ttagaacatctagaacagcaatcagtccagcatgcttttctggcagtatttgaccgtgag
ccacacagtattctgcaacgcttgcagcaatttcagaaactacaacaacagctacagcag
caggcaccggcacatgcgtacagttcactggcccagttgcaacagcagctgaacgatgtt
aaacagcaacaggccgatgcgctccagcaggccggttcgctggctgaactggaacagcaa
gcaacagaactggaacagcagcaggtacagcaccagcaacacagtcagcagctggaacag
gccctgttcctgttacaacacatgctgagtgaacagcaggaacagcagcaattacagcag
cacatcacccagcttcaggccgagctgagcagcttgcaacaggcgcaaactgaagcacag
cagcactaccaaaatgcccagacggcccgtgaacagctggaacagatttttgcccagcag
cgtttattacaggcgcaaagtgtgcaggagctgcgtcaacaactgcaagcggaacagccg
tgtatggtctgtggcagtactgagcatccatttgtcagtcatcaggatttgctggaatct
gcactgcagtcggtgcaggacacccagttacaacaggcccagcagcaggaacagcagtgt
cagcagcaacttcagcaattacaactacaacattccaaacagcaaaccctgctggaacag
aaacagctacgctctagtcagcttcaagacagcgtgcaacagaaactgcagcaggttcaa
acactcagcccaagcacacagctggatgatacagcgcacgatctaactgccttgcagact
accctgcaacacaagctaaatcagcagcaacagcagttacagcagctaaaaacccgccag
caacagctgaaaaaccagacccagcagctgcaacatttgcagcagcagattcagactctg
cagttactctgtcagcaattccagcagctggaacaactgattgaaccggtcacccaggca
ctggaaccagcccagcaagcacaatgggcgaaccaggccgagatgtgtcagactcttatt
gccctgctgagcagccggactcaatatctacaacagcgcgaacagtgcctgcaacagcag
caggaattacagcgccagatcaaagacggtgaacagcaattacagttctatcagcagcaa
cagcagcagctgagcaatgaccgtacccatgcacaaactcaaggcagccagttgcgccag
caggtacgtgatctcagccagcaacataccggacaggtgctggataccggcaaagcctgg
cagcacctgttacgagagcagcagcaacaactccagcagcaggtagaacagcaacgtctg
cactgccgtcagctggaacagcaattccagcaggcgcagctgaaacagcaaggtctgcat
acgcgccagcagcagcttctggaaagtgtgcagcagctacagcacaacattcagcagtgg
caaagccagcatccacagtttacagccgagcagatcgaacaatgtctgggtattgatctg
gccagctggcaggccatacgtcaggccatccagcaacagcagcaagccatgctcagtgca
caaagtgcgctagatgtattgcaagagcaattccagcagcatcaggcccagcaaccaacc
accagttatgatgaggtgaccacccaattggaacagctggaacaggaaaaaaacagcttg
caggagcagtttaaccagctggaaacccagttacgtatgcagcaacaggcgcaggcacaa
ctgtccaaattccagagccagattgaaaaaattcaggccgaagaatatcgctggggccga
attgctgatttaattggcagcaaggaagggaccaaattccagaaaattgcccaggaacat
catctggatattctggtggaacatgccaaccagcaattgcagccgctggcgccgcgttat
cagctacagcgtattcccaacagtctgggcctcgcaattctggatcatgacatgaacggc
gaaatccggccggtactatctttatcggggggtgaaaccttcctggtatcactggcgctg
gcgctggccattgccaatatggcctccggctccatgaaactggaatcgctgtttattgat
gaaggctttgggacgctcgacccggcctcgctacatatggtcatgaatgcgctcgaccgg
ctgcaaagccaaggccgtaaagtggtactgatttcccatattcaggaaattcatgaacgg
attccggtccagattcaggtcaaaccaattggtgccggggccagtaccctgcagatcgta
ggctag

DBGET integrated database retrieval system