KEGG   Acidaminococcus intestini: Acin_1525Help
Entry
Acin_1525         CDS       T01639                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ain  Acidaminococcus intestini
Pathway
ain00473  D-Alanine metabolism
ain00550  Peptidoglycan biosynthesis
ain01100  Metabolic pathways
ain01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ain00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Acin_1525 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Acin_1525 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Acin_1525 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ain01011]
    Acin_1525 (ddlA)
Enzymes [BR:ain01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Acin_1525 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:ain01011]
 Precursor biosynthesis
  Amino acid ligase
   Acin_1525 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 GARS_A ATP-grasp_4 ATP-grasp RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AEQ22744
UniProt: G4Q2T8
LinkDB All DBs
Position
complement(1551662..1552600)
Genome map
AA seq 312 aa AA seqDB search
MMKTKRIGVVMGGPSKEREVSLNTGSAIVEALKEKGYDAVPIDLDPSLFPSQIEDAGVKV
VFNAVHGLYGEDGRLQAVLEMLGVPYTGSGVLSSAIAMNKFYTKRMFEANGVKTANCLYL
TDKDRQTAKQDIIRKLGIPCVVKPAEQGSSIGVTIVKKEEDLDKALEEAFSYGKLVLAEA
FFTGKEVAAGVMMDSSGNPIAMPLVLIEPHVDFYDYHNKYTKGATTYTCPAPFDECLTKA
LQEEAVKAYKALGCSGVARVDEMVDAEGNFICLEVNTIPGMTATSLVPKAAKAMGLSFPD
LCEKILETAHLG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagacaaaacgaattggcgttgttatgggcggccccagcaaggagcgggaagta
tccctgaatacaggctcggccattgtggaagcgttaaaggaaaaaggttatgacgcggta
cccatcgaccttgatccgtcccttttcccctcccagattgaggatgcaggagttaaagtc
gtttttaatgccgtccacggtctttatggagaagatggaaggctgcaggccgtccttgaa
atgcttggcgttccttacacagggtcgggcgttctttcaagcgccattgccatgaataag
ttctacaccaagcgaatgtttgaagcaaacggcgtaaagaccgctaactgcctttatcta
accgataaagacagacaaacggccaaacaagatatcatccgtaagcttggaattccttgc
gtcgtcaaaccggcagaacagggttcgagcattggcgtgaccatcgtcaaaaaggaagaa
gacctggataaggcccttgaagaagcgttttcctatggaaaactggtccttgccgaagct
ttctttacgggtaaggaagtggccgcgggcgtcatgatggatagcagtggaaacccgatt
gcgatgccccttgtcctcattgagccccatgtcgacttttatgactaccacaataaatat
actaagggagccacgacctacacctgcccagcaccttttgatgaatgcctcacaaaggcg
ctccaagaagaagccgtcaaggcctataaggcccttggctgcagtggggtcgcccgcgtt
gatgaaatggttgacgcagaaggcaacttcatctgccttgaagtaaataccattcctggc
atgacggcaacgagccttgtgccaaaagcagcaaaggccatgggtctgtctttcccggat
ctgtgtgaaaagatccttgagacggctcatttgggctaa

DBGET integrated database retrieval system