KEGG   Acidaminococcus intestini: Acin_1813Help
Entry
Acin_1813         CDS       T01639                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ain  Acidaminococcus intestini
Pathway
ain00473  D-Alanine metabolism
ain01100  Metabolic pathways
ain01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ain00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Acin_1813 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Acin_1813 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ain01011]
    Acin_1813 (alr)
Enzymes [BR:ain01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Acin_1813 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ain01011]
 Precursor biosynthesis
  Racemase
   Acin_1813 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEQ23024
UniProt: G4Q3V8
LinkDB All DBs
Position
complement(1830576..1831721)
Genome map
AA seq 381 aa AA seqDB search
MRARNVWAEVDLSAIAHNVQVTRKVLKPGTKICAVVKADAYGHGAVPVATAALAAGVNYL
AVSMTQEALELREAGIMAPILILGTMTEEHEKALVDYNITQTVYDLAVAQELSAAALQEN
KVAKVHLAVDTGMNRIGCRPEEAADLAEAISKLPHVELEGMFSHFASADEMDKSFAESQY
RKFMEADRAIKDRGIQIPLVHIDNSAGITEMKHTECDMVRQGITLYGLWPSDDVERCLDL
KPALSLKAEVVFVKDVPAGEKIGYGCTYETKAPMKVATIPLGYADGYSRALSNRGYITIR
GYKAPVVGRICMDQFMVDVTNVPGVHKGDEAVIFGPGGVSLDQLAKWVGTIPYELMCLLS
TRVPRKYTYTYTIKHYENNRF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgaggaatgtttgggccgaagtcgatctgtcggccattgcccataacgtacag
gtcacgcgcaaagtcctcaaaccggggacaaaaatctgcgcggttgtcaaagctgatgcc
tatggccacggagccgtgcccgttgcaacggcagccctggcggcaggcgtcaattatctg
gcggtgtccatgacacaggaagccctggagcttcgcgaagctggtatcatggcgcctatc
ctcattttggggaccatgacggaagaacatgaaaaggcccttgtggactataacatcacc
caaacggtctatgatcttgccgtggcccaggagctttcggcagcagccctgcaggaaaac
aaggtggccaaggtccacctggctgtcgatacggggatgaaccggatcggctgccgtcct
gaagaagcggccgatcttgctgaggccatcagcaagctgccccatgtggagcttgaaggg
atgttttcccattttgccagcgccgatgaaatggataaaagttttgctgaaagccaatat
cgaaaattcatggaagctgaccgcgctatcaaggaccgaggcatccagattcccttggtc
cacatcgataacagcgctggtatcacggagatgaagcatacagaatgtgacatggtccgt
cagggcatcaccctttatggactgtggccatcggacgacgtagaacgctgtcttgaccta
aaaccggccctcagcctcaaggcagaagtcgtctttgtgaaggatgttccagccggtgag
aagatcggttatggctgtacctacgagacgaaagcacccatgaaggtagctacgattccc
ttgggctatgctgatggctattcccgcgccctgtcaaaccgtggctatattacgatccgt
ggttataaggctcctgttgtgggtcgcatctgtatggaccagtttatggttgacgtgacg
aatgtgccgggtgtccataagggggatgaagcggttatctttggaccgggcggtgtttcc
cttgaccaattggctaagtgggtgggaaccataccctatgagctcatgtgtcttttgtca
acgcgcgttcccagaaagtacacctacacgtataccatcaagcattacgaaaacaatcgt
ttttag

DBGET integrated database retrieval system