KEGG   Actinobacillus indolicus: EXH44_00635Help
Entry
EXH44_00635       CDS       T05940                                 

Definition
(GenBank) SDR family oxidoreductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aio  Actinobacillus indolicus
Pathway
aio00061  Fatty acid biosynthesis
aio00780  Biotin metabolism
aio01100  Metabolic pathways
aio01130  Biosynthesis of antibiotics
aio01212  Fatty acid metabolism
Module
aio_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aio00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EXH44_00635
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EXH44_00635
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    EXH44_00635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aio01004]
    EXH44_00635
Enzymes [BR:aio01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     EXH44_00635
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     EXH44_00635
Lipid biosynthesis proteins [BR:aio01004]
 Fatty acid synthase
  Component type
   EXH44_00635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: QBQ62842
UniProt: A0A4V0ID16
LinkDB All DBs
Position
139998..140786
Genome map
AA seq 262 aa AA seqDB search
MGFLAGKRILVTGLASNRSIAYGIAKAMKAQGAELAFTYLNDKLQPRVEEFAKEFGSDIV
LPLDVATDESITNCFAELSKKWEKFDGFVHAIAFAPGDQLDGDYVNAATREGYRIAHDIS
AYSFVAMAQAARPFLNKDAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKE
GIRVNAISAGPIRTLAASGIKNFKKMLAAFEQTAALRRTVTIEDVGNSAAFLCSDLASGV
TGEVLHVDAGFSITAMGELGEE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggctttttagctggaaaacgtattttagtaacaggtttagcaagcaaccgttcgatt
gcttacggtattgcaaaagcaatgaaagcacaaggtgcagaattagcctttacctattta
aacgacaaacttcaaccacgtgttgaagagtttgccaaagagtttggttcagatatcgta
ttaccattagatgtagcgacagatgaaagcatcacaaactgctttgcagaattaagcaaa
aaatgggaaaaatttgacggttttgttcacgcaatcgcctttgcaccaggtgatcaatta
gacggcgactatgtcaatgccgcaacccgtgaaggctaccgcattgcccacgacatcagt
gcatacagcttcgtggcaatggcacaagcagctcgtccattcttaaacaaagatgctgca
ttattaactctttcttacttaggcgcagaacgtgcgatccctaactacaacgttatgtgt
ttagccaaagcatcacttgaagcagcaacacgcgtaatggcagcggatttaggtaaagaa
ggtatccgtgttaatgcgatctctgcaggtccaatccgtacgcttgcagcatcaggcatc
aaaaacttcaagaaaatgcttgcagcattcgaacaaaccgcagcattacgccgtactgta
acgattgaagatgtgggtaactcagctgcattcttatgttctgatcttgcttcaggcgta
acaggcgaagtattgcacgtagatgcaggctttagcatcacagcaatgggtgagctaggc
gaagagtaa

DBGET integrated database retrieval system