KEGG   Arachis ipaensis: 107604890Help
Entry
107604890         CDS       T04301                                 

Definition
(RefSeq) histidine biosynthesis bifunctional protein hisIE, chloroplastic isoform X1
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
aip  Arachis ipaensis
Pathway
aip00340  Histidine metabolism
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
aip01230  Biosynthesis of amino acids
Module
aip_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    107604890
Enzymes [BR:aip01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     107604890
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     107604890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-GeneID: 107604890
NCBI-ProteinID: XP_016162086
LinkDB All DBs
Position
B06
AA seq 290 aa AA seqDB search
MTISYAHMLQFSTSFLNGKLSFTSDNKGRRTHILPFASLERPDKNIVIDPKFCQVDSLLD
SVKWDDKGLAVAIAQNVDTGAILMQGFANREAVFTTLSSRKATFFSRSRSTLWTKGETSN
NFINIHDVFLDCDRDSIIYLGKPDGPTCHTGAETCYYTSVFDSLKQQEIEGNRLALTSLY
SLESTISQRKAELAEEENGKPSWTKRLLLNDKLLCSKIREEANELCQTLENNEDKSRTAS
EMADVLYHAMVLLAVKDVKVEDVLQVLRQRFFQSGIEEKKSRVSKKSEQD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttcctatgctcacatgcttcaattttccactagtttcctcaatggcaagcta
tcatttaccagtgacaataaagggagaaggacacacatcttaccttttgcttcgttggag
agaccagacaaaaatattgtcattgaccccaagttttgtcaggtagactctctgctggac
agtgtaaaatgggatgataaaggtttggctgtggcaatagctcagaatgttgacactgga
gccatattaatgcaaggttttgcaaatagagaagcagtgtttacaaccctatcttcccgg
aaggctacgttcttcagtcggtcacggtcaacattgtggaccaaaggagagacttctaat
aattttataaatattcacgatgtttttcttgactgtgatcgtgattctataatatacctc
gggaaacctgatggacctacctgccacacaggggcagaaacatgctattatacatcagtc
tttgactcactaaaacagcaagagattgaaggaaataggttggcattaacctctttgtat
tcattagagtcgacaatctcccaacgcaaagcagagttagcagaagaagagaatggaaag
ccctcatggactaagcgattattgctcaatgataagttgttgtgctcaaaaatcagagaa
gaggcaaatgagttgtgtcaaacactagagaataacgaggacaagtcacgtactgcttca
gagatggctgatgtactctatcatgcgatggtactgttggcagtgaaagatgtcaaagta
gaagatgttctgcaggttcttcggcagagatttttccaatctggtatcgaggaaaagaaa
agtcgagtatccaagaaatcagagcaagattga

DBGET integrated database retrieval system