KEGG   Arachis ipaensis: 107606028Help
Entry
107606028         CDS       T04301                                 

Definition
(RefSeq) cyclin-A1-1 isoform X1
  KO
K06627  cyclin-A
Organism
aip  Arachis ipaensis
Brite
KEGG Orthology (KO) [BR:aip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aip03032]
    107606028
   03036 Chromosome and associated proteins [BR:aip03036]
    107606028
DNA replication proteins [BR:aip03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    107606028
Chromosome and associated proteins [BR:aip03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    107606028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C RTP801_C
Motif
Other DBs
NCBI-GeneID: 107606028
NCBI-ProteinID: XP_016163477
LinkDB All DBs
Position
B07
AA seq 499 aa AA seqDB search
MSNRRSSFSSSTTSSLAKRHASASSTENHNAGKVSLAKKRAPLTNLTNNISQRSSLVPCA
TKVAKTKKEASSCNTTTTCSSISSNKIPILQSAVKCNAVVFPKPSYVSAREEGDAKKVVV
AVAAAAAPVSVHISKMDVSPCKSDGASVSMSVDETMSSCESFKSPDIEYLDNNDIAPAVD
SIQRKTFSTLNISDTPEPPAGNICSRDILVELEKDDKVVNVDNNFMDPQLCATFACDIYK
HLRASEAKKRPSTDFMESVQKDINPSMRAILIDWLVEVAEEYRLVPDTLYLTVNYIDRYL
SGNPMNRQKLQLLGVASMMVASKYEEICAPQVEEFCYITDNTYFKEEVLQMESAVLNYLK
FEMTAPTIKCFLRRFVRAAQGVSETPSLQLECLTNYIAELSLLEYSMLCYAPSLIAASAI
FLAKFILSPSTKPWNATLKHYTQYQPSDLCSCVRDLHRLCCNNPNSNLPAIREKYSQHKY
KNVAKKCCPSSIPSEYFQN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaccgtcgttcatcgttttcttcctcaacgacgtcgtctttggcaaaacgccat
gcatcggcgtcgtcaaccgaaaaccacaacgcgggaaaggtttcccttgcgaagaagcga
gcgccgctaacaaacctcaccaataacatttctcaacgctcttctctggtaccttgtgct
actaaagttgctaagacgaagaaagaggcttcatcatgtaacactactacaacttgttct
tcaatttcaagcaacaagataccgattttgcagagtgctgtaaagtgcaatgctgttgtt
tttccgaagcctagttatgtctctgcaagggaagaaggtgatgctaagaaagttgttgtt
gctgttgctgctgctgctgcccctgttagtgttcatatctcaaaaatggatgtttctcct
tgtaaatcagatggggcatctgtttccatgtctgtggatgagaccatgtcttcttgtgaa
tctttcaagagccctgacattgagtatttggacaacaatgatatcgcgccggccgttgat
tcaattcagaggaagacattcagcaccctcaacatttctgatactccagagccaccagca
gggaacatatgcagtagagacatacttgttgagttggagaaagatgacaaagttgtgaat
gttgataacaacttcatggatccccagctttgtgcaacatttgcttgtgatatatacaag
cacctgcgtgcatctgaggcaaagaaaagaccttccacggacttcatggagagtgttcag
aaggacataaatcccagcatgcgtgctatattgattgattggcttgttgaggtagccgaa
gagtatcgattggtacctgatacattgtatttgacagtgaactacatagataggtatctt
tcagggaatccaatgaacaggcaaaaattacaattacttggtgttgcttccatgatggtt
gcctctaaatatgaggagatttgtgcaccccaggtagaggaattttgttacatcaccgac
aacacatacttcaaagaagaggttttgcaaatggaatctgctgtcttgaattatctgaag
tttgaaatgacagctccaacaattaagtgtttcttaagacggttcgttcgtgcagctcaa
ggagtcagtgagaccccttcgttgcaactagagtgcttgacaaactacattgccgaattg
tctttgttggagtacagtatgctttgttatgctccgtcactaatagctgcttctgcaatt
tttctagccaagtttatactctccccctcaaccaaaccatggaatgctacattgaagcac
tatacacaataccagccctctgatttgtgtagttgtgtaagggatctccatcgactttgt
tgcaacaatcctaactccaatttgcctgcaattagggaaaagtatagtcagcacaagtac
aaaaatgtggccaagaagtgttgcccttcctcaataccttcagaatattttcagaattga

DBGET integrated database retrieval system