KEGG   Arachis ipaensis: 107609102Help
Entry
107609102         CDS       T04301                                 

Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aip  Arachis ipaensis
Pathway
aip00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aip00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    107609102
Enzymes [BR:aip01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107609102
Transporters [BR:aip02000]
 Other Transporters
  Pores ion channels [TC:1]
   107609102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 107609102
NCBI-ProteinID: XP_016166424
LinkDB All DBs
Position
B07
AA seq 151 aa AA seqDB search
MAASLVELLPKEYGYVVIVLVLYVFLNFYMAFQVGMARKKYNVPYPTLYALESENKQANL
FNCVQRGHQNSLETMPIFFMLMIMGGLKHPSVCAGLGLLHVVARYFYFTGYSTGDPAKRL
TLGKFHMLAILGLIVCTISCGRSLLDQPTSS
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatctctcgtagaattgctcccgaaagagtacggttacgtcgtcatcgttctc
gttctctatgtcttcctcaatttctacatggcattccaagtcggcatggctcgcaagaag
tacaatgtcccttatcccaccctttatgcccttgaatccgaaaacaaacaagccaatctc
tttaactgtgttcagagaggacatcagaactctttggaaacaatgcccatattcttcatg
ctcatgattatgggagggttgaagcacccttcagtttgtgcgggccttgggttgcttcat
gttgttgctcgctatttctacttcactggctattccactggtgatcccgcgaagcgactc
actctcgggaagtttcatatgctggcaattctgggtcttattgtgtgcacaatttcatgt
gggcggagccttctcgatcagcctactagctcctga

DBGET integrated database retrieval system