KEGG   Arachis ipaensis: 107617500Help
Entry
107617500         CDS       T04301                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
aip  Arachis ipaensis
Pathway
aip00562  Inositol phosphate metabolism
aip01100  Metabolic pathways
aip04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107617500
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107617500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aip01009]
    107617500
Enzymes [BR:aip01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107617500
    3.1.3.48  protein-tyrosine-phosphatase
     107617500
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     107617500
Protein phosphatases and associated proteins [BR:aip01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    107617500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 107617500
NCBI-ProteinID: XP_016174752
LinkDB All DBs
Position
B09
AA seq 617 aa AA seqDB search
MESVPADVSNLPPSKDPSPSPPVKETDGQASSAPVAFGQDSSAHVAPSKPSSTGASSWAK
NLNISQPSGSQDDPSTGNAGKSTFARITSNLGLRLSPKSPPADDSSNETPAQSNIFGSIT
RGLVDTSKNAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFF
GYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPLQ
LVISFCHSAYSWLKLDIENVVVVHCKAGMARTGLMISSLLLFLKFFPTAEESMDYYNQKR
CVDGKGLVLPSQIRYVKYFERVLTYFNGENPPARRCMLRGFRLHRCPYWIRPSITVSDHS
GVLFSTKKHPRTKDLLPEDFWFSAPKKGVMVFALPGEPGLTELAGDFKIHFHDRQGDFYC
WLNTTMTENRKVLNTNDLDGFDKRKLPSPGFLVEVVLVDYNGNVVASEPEATGKRSDESS
SNSATPVEASIPAQNTDKESGSRDKDDVFSDGESEHSASSRSKQAKPASEPVKTVNKATS
GSETNKISNQVANLTNATEQVSLGSASSKPVHAGQPKSDNERTVSGVEMASSESEFKAMA
ADASVFTFGDDEDYESD
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggaatcggtccctgctgatgtatcaaatttacctcctagtaaagacccatctccttca
cctccagtcaaagagaccgatggacaagcttcttcagctcctgtagcctttgggcaagat
agttctgcacatgtggcaccatctaagccatcctccaccggggcatcatcttgggccaaa
aacttgaacatttctcagccatctggctcacaagatgacccatccactggaaatgctggg
aaatcaacctttgcccgcataaccagtaatttgggattgcgtttgtcaccaaagtctcct
ccggcagatgacagttccaatgagacaccagcacaatctaatatttttggaagtatcaca
agaggtttggttgacacttctaagaatgcagtgaaagctgtccaggttaaggcacgacat
gtcgtttctcagaataaacgcagatatcaggaaggaggttttgatttagatatgacatat
atcacagaaaacatcattgctatggggttccctgctggtgacatgagctctgggtttttc
ggttatgttgaaggattttacagaaatcatatggaagaagttattaagttttttgagact
caccataaggataaatacaaagtatacaatctttgttctgagcggctgtatgatgcatca
ttgtttgagggaaaggtggctagctttccatttgatgaccataattgccccccacttcaa
ctggttatctcattctgtcatagtgcatactcgtggttgaagttagatattgagaatgtt
gtggttgtccactgtaaggctggaatggcaagaacagggttgatgatttccagtcttcta
ttattcttaaagttctttccaactgctgaggagtcaatggattactataatcaaaaacga
tgtgttgatggaaaaggacttgttctgcccagtcagattaggtatgtcaaatattttgaa
cgtgtcttgacttacttcaatggcgaaaacccacctgcccgtaggtgcatgcttagggga
tttcggcttcacaggtgcccttactggatcaggccctctataactgtctcagaccatagt
ggtgtgctgttctctaccaaaaagcatccaaggaccaaggatcttttgccggaagatttc
tggttcagtgctccaaagaagggagtaatggtctttgctttgccaggagagcctggtctt
acagaattggctggggacttcaaaattcattttcatgatcgccaaggagacttttactgt
tggttgaacacaactatgacagaaaatagaaaagtattgaacaccaatgatcttgatggc
tttgacaagaggaaattgccttctccaggattcctggttgaggttgtgctggttgattat
aatggtaatgttgtggcttccgaacccgaggctactggaaaaagatcagatgagagttca
agtaatagtgccaccccagttgaagcaagcatacctgcgcagaatacagacaaagagtca
gggagtcgagataaagatgatgtgttttcagatggtgagtcggagcattctgcttcttca
agaagcaagcaagcaaaaccagcttctgaaccagttaaaacggttaacaaggctaccagt
ggatctgaaaccaacaaaatttcaaatcaagttgcaaatctaacaaatgcaacagaacaa
gtttctttgggaagtgcaagctcgaaaccagttcatgctggtcaaccaaaaagtgataat
gaaagaactgtgtccggtgttgagatggccagctcagaaagtgagtttaaggccatggct
gcagatgcatctgtttttacatttggagatgatgaagactacgaaagtgattaa

DBGET integrated database retrieval system