KEGG   Arachis ipaensis: 107618348Help
Entry
107618348         CDS       T04301                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aip  Arachis ipaensis
Pathway
aip00010  Glycolysis / Gluconeogenesis
aip00020  Citrate cycle (TCA cycle)
aip00620  Pyruvate metabolism
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
aip01200  Carbon metabolism
Module
aip_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107618348
   00020 Citrate cycle (TCA cycle)
    107618348
   00620 Pyruvate metabolism
    107618348
Enzymes [BR:aip01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     107618348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 107618348
NCBI-ProteinID: XP_016175868
LinkDB All DBs
Position
B09
AA seq 475 aa AA seqDB search
MASSPSPFTLSFSSSISSTSLLPCRRSFILPIPRGRATSFTVQSKIREIFMPALSSTMTE
GKIVSWIKSEGETLSKGESVVVVESDKADMDVETFYDGILAAIVVPDGETAPVGAPIALL
AETEEEVAEAKAKAAKSSQSQSSAPPPQPANPAPAISQPSPPPPPPPSAAASDGPKKTVA
TPQAKKLAKQHKVDLASLAGTGPFGRITPADVETAAGIAPSKSSPAPAAPAPASSAPPKA
AAAGAVAPPPIPGSSVVTFTTMQSAVAKNMVESLSVPTFRVGYPVITDALDALYEKVKPK
GVTMTAILAKAAAMALVQHPVVNASCKDGKNFAYNSNINIAVAVAINGGLITPVLQDADK
LDLYLLSQKWKELVNKARGKQLQPNEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVG
ASKPTVEADATGFFKVKNKMLVNVTADHRIIYGADLAAFLQTFSKIIENPDSLTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctccttcaccattcaccctctcattctcctcttcaatctcatccacatcc
ctcctcccatgccgtcgcagcttcattctcccaatccctcgaggccgcgctacttcattc
actgtccaatccaagatccgagaaatcttcatgcccgcactcagctccactatgactgag
ggcaaaatcgtctcttggatcaaatccgagggcgagactctctccaagggtgagagcgtc
gtcgtcgtcgaatccgacaaagctgacatggacgtcgagacattctacgatggaatactc
gccgccatcgtcgtccccgacggcgaaacagcccccgttggagctcccatcgccttactc
gccgagacggaggaagaagtcgccgaagccaaagccaaagctgccaagtcatcacaatcc
caatcctctgcgcctcctcctcagcctgcaaatccagctccggcaatttctcagccttct
cctcctcctcctcctccgccatcggcggcagcttctgacggaccgaagaagaccgtcgcc
acgcctcaggcgaagaagctcgcaaagcagcacaaggtagaccttgcgtctctcgccggg
accggtccgtttggtcggatcactccggccgacgtggagaccgctgctgggattgcgcca
tcaaagagcagtcctgctccggcggctcctgctccggcgagctcagctcctccaaaagca
gctgctgctggtgcagtggcgccgcctccaattccaggctctagcgttgttacattcacg
acaatgcaatctgcagttgcaaagaacatggtggagagcctctccgtgcctacattccgt
gttggttatcctgtgatcactgatgcacttgatgctttatatgagaaggtgaagccgaag
ggggtgacaatgacagcaattttggccaaggctgctgcaatggcacttgtccaacatcca
gtggtcaatgccagctgcaaagatggcaagaactttgcctataacagcaacatcaacatt
gcagttgctgtggcaatcaacggcggtttgattacccctgtacttcaggatgctgacaag
ttggacttgtatctgctgtcccaaaagtggaaagagctagttaataaagctcgtggaaag
caattgcaacccaatgagtataattcaggaactttcacactctccaatctgggcatgttt
ggagttgacaggtttgatgccatacttcctccagggcagggggctatcatggcagttgga
gcatcaaagcctactgtcgaggctgatgcaactggattcttcaaggtgaaaaataagatg
ctggtgaatgtaacagctgatcaccgaataatttatggcgctgatttggccgccttcctt
cagacattctccaaaatcattgaaaacccagacagtctaacattgtag

DBGET integrated database retrieval system