KEGG   Arachis ipaensis: 107619088Help
Entry
107619088         CDS       T04301                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3-like isoform X2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
aip  Arachis ipaensis
Pathway
aip00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aip00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107619088
Enzymes [BR:aip01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107619088
Chromosome and associated proteins [BR:aip03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107619088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF682
Motif
Other DBs
NCBI-GeneID: 107619088
NCBI-ProteinID: XP_016176786
LinkDB All DBs
Position
B09
AA seq 349 aa AA seqDB search
MPTMKKNSEQTSFGLVFSKLAEEIGEPVDFELPEWFNKCKPMPVTFIKRNIYLTKRVKRR
LDDDGIFCSCTSSPGSSAVCGKDCHCGMLLSSCSSGCKCGVSCLNKPFQHRPIKKMKLVQ
TEKCGSGIVADEDIKQGEFVIEYVGEVIDDKTCEERLWNMKLRGVTNFYLCEINRDMVID
ATYKGNKSRYINHSCCPNTEMQKWIIDGETRIGIFATRDIRKGEHLTYDYQFVQFGADQD
CHCGANMCRRKLGVKPTKPKTSSDAALNLFGDQVYQNGGLHIGNSRLFCQSNCLRNCIGE
VVRIRHLDIIRFGIIKRFHEYSKKHSIMFEDGHVEFFDMSKEDWELVTL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccatgaagaagaattctgaacaaacatcttttgggttagtatttagcaaattg
gcagaggagattggtgaacctgtcgactttgaacttccagaatggtttaataagtgcaag
ccaatgccagtaacatttataaaacgcaatatatatctgacaaaaagggttaaaagaagg
cttgatgacgatggcatattttgttcttgtacatcatcacctggatcttctgctgtatgc
ggtaaagattgccactgtgggatgcttctgtctagctgctcttcaggctgtaaatgtggg
gtttcctgtcttaacaaaccattccagcatcgacccatcaaaaagatgaaattagttcag
actgagaaatgtggttctggaattgtggcggatgaagatatcaagcaaggagaatttgtg
atagaatatgttggagaagtcattgatgacaaaacatgtgaagaaagattatggaacatg
aaacttcgtggggtgacaaacttctacctatgtgaaataaatcgagatatggtgatcgat
gcaacatataaaggaaacaaatcaagatatatcaatcatagttgctgtcctaatactgag
atgcagaaatggataattgacggtgaaacgagaattggcatattcgcaacgcgcgacata
aggaaaggcgaacatctgacatatgattatcagtttgtccagtttggtgcggatcaggat
tgccactgcggggctaatatgtgcaggcgtaagcttggtgtgaaacctaccaagcctaaa
acttcttcagatgctgcattaaatttattcggagaccaggtttatcagaatggaggtttg
catattggaaattcccgcctcttttgccaatcaaactgccttcgcaattgcattggtgaa
gttgttagaatcagacaccttgatattataaggttcgggattattaagcggtttcatgaa
tattcgaagaaacactcgatcatgtttgaggatggacatgttgaattttttgacatgtcc
aaggaagattgggaactggttacattgtga

DBGET integrated database retrieval system