KEGG   Arachis ipaensis: 107619525Help
Entry
107619525         CDS       T04301                                 

Definition
(RefSeq) hexokinase-2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
aip  Arachis ipaensis
Pathway
aip00010  Glycolysis / Gluconeogenesis
aip00051  Fructose and mannose metabolism
aip00052  Galactose metabolism
aip00500  Starch and sucrose metabolism
aip00520  Amino sugar and nucleotide sugar metabolism
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
aip01200  Carbon metabolism
Module
aip_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aip_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107619525
   00051 Fructose and mannose metabolism
    107619525
   00052 Galactose metabolism
    107619525
   00500 Starch and sucrose metabolism
    107619525
   00520 Amino sugar and nucleotide sugar metabolism
    107619525
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107619525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aip04131]
    107619525
Enzymes [BR:aip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107619525
Membrane trafficking [BR:aip04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107619525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 bact-PGI_C
Motif
Other DBs
NCBI-GeneID: 107619525
NCBI-ProteinID: XP_016177304
LinkDB All DBs
Position
B09
AA seq 495 aa AA seqDB search
MGRVVVVAAVIGVATAVAVAAVVGRRFVRKWRRRAKALAIVKEVEEKCATPIAKLRQVAD
AMTVEMHAGLASEGGSKLKMLITYVDNLPTGDEEGLFYALDLGGTNFRVLRVQLGGKEGG
IVSQEFTEVSIPPKLMVGSSSALFEFIASKLAKFVAEEGPDFQIPTGRQRELGFTFSFPV
MQTSIDSGNLIKWTKGFSIDDTVGKDIVAELTKAMEKQGLDMRVTALVNDTVGTLAGGRY
TDKDVIAAVILGTGTNAAYVERAQAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEFDH
ALDMESLNPGEQVYEKIISGMYLGDIVRRVLCKMAEEASFFGDTVPPKLKVPFTLRTPDM
SAMHHDTSADLSVVGNKLKTIFEIQDSSLESRKVVIELCNIIATRGARLAAAGMLGILKK
LGKDTINDGEGQRFVIAMDGGLYEHYDAYSKCLEDTMAELLGEVVSQNIVIKHSMDGSGI
GAALLAASHSQYLEG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgagtggtggtggtcgcggcggtgattggggtggcgacggcggtggctgtagca
gcagtggtaggtcgccggtttgtgagaaaatggcgtcgtagggcgaaggcattggcgata
gtgaaggaggttgaggagaagtgcgcaacccctatcgccaagctgagacaggtggcggat
gccatgaccgttgagatgcacgccggtctcgcatctgagggtggcagtaagctcaagatg
ctcatcacttacgtcgataatctccccactggggatgaggaaggactattttatgcattg
gaccttggaggaactaactttcgtgtattacgtgtgcaactcgggggaaaggaaggtggt
attgttagtcaagaatttactgaggtgtcaattccgcctaagttgatggttggatcatca
agtgcactatttgaatttattgcatcaaaacttgcgaaatttgttgccgaagaaggacca
gattttcaaattcctactggtagacagagggaactaggtttcaccttttccttccctgtc
atgcaaacatcaattgattctgggaaccttataaagtggacaaaaggcttctccatagat
gatacagttggtaaggatattgtggcagaattgacaaaagccatggagaagcaaggcctt
gatatgcgtgtaacagctctggtcaatgatacagttggaacattagctggaggtcgatac
acagacaaagatgtcattgctgctgttattttaggtactggaacaaatgcagcatatgta
gagcgtgctcaagcaataccaaaatggcatggtcttttgcccaagtccggagaaatggtt
attaacatggagtggggaaatttccggtcttcacatcttcccttaactgagtttgatcat
gcattagatatggagagtttaaacccgggtgaacaggtttatgagaagataatttctggt
atgtatttgggagatattgttcgaagagtgctatgtaaaatggctgaagaagcttccttt
ttcggggacacggttcctccaaaattgaaagttccgttcacattaaggacacctgacatg
tctgcaatgcatcatgacacatctgctgatctcagtgtagttgggaacaaactaaagacc
atttttgagatacaagatagttcattggaatcaaggaaggtggttattgagctctgcaac
attattgctacacgcggcgctcgtcttgccgctgccggcatgttgggtatcctgaagaag
ctggggaaagacaccatcaatgacggtgagggtcaaaggtttgtgatagccatggatggt
ggattgtatgagcattatgatgcatacagcaagtgcctagaggataccatggctgagttg
cttggtgaagttgtctcacaaaacattgtcataaagcactccatggatggttctggaatt
ggtgctgctcttcttgctgcttctcattctcagtaccttgaaggctaa

DBGET integrated database retrieval system