KEGG   Arachis ipaensis: 107625358Help
Entry
107625358         CDS       T04301                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aip  Arachis ipaensis
Pathway
aip00564  Glycerophospholipid metabolism
aip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107625358
Enzymes [BR:aip01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     107625358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA Pyr_redox Pyr_redox_3 HI0933_like 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 107625358
NCBI-ProteinID: XP_016183458
LinkDB All DBs
Position
B02
AA seq 632 aa AA seqDB search
MTATARLRRIGTAVAAAVTTAYGGTILLVPPVSANDHGGSGSHLAAIRQKIHDPSATIPS
REVQRSSLIGTSPANPLDVLVIGGGATGSGVALDAVTRGLRVGLVEREDFSSGTSSRSTK
LIHGGVRYLEKAVFKFDYGQLKLVFHALEERKQVIDNAPHLCNALPCMTPCFDWFEVVYY
WIGLKMYDLIAGARLLHLSRFYSTEESVELFPTLAKEGKGRRLRGTVVYYDGQMNDARLN
VGLACTAALAGATVLNHAEVVSLLKDDIGERIIGAQIRDTLTGKEFDTYAKVIVNAAGPF
CDSIRKMADKNARDMICPSSGVHIILPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAG
TTDSNTAITFLPEPHEDEIQFILDAISDYLNVKVRRTDVLSAWSGIRPLAMDPSAKNTES
ISRDHVVCEDLPGLITITGGKWTTYRSMAEDAVDAAIKSGKLTPTSGCVTHNLHIVGGEG
WDPASFTVLTQQYMRMKISYKGKVVPGVMDTASAKHLSHAYGTLAERVAAIAQDECLGKR
LAHGYPFLEAEVAYCARHEYCESAIDFIARRTRLAFLDTDAAGRALPRVIQILAAEHKWD
KSRQKQELQKAKEFLETFKSSKNAQFHDGKHN
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaacagctcgtctgaggcgaattggcaccgctgtcgcagcagccgtcaccact
gcatatggcggcacaatccttctcgttcctcccgtctctgccaatgatcatggtggcagt
ggatcccaccttgccgccatccggcagaagatccacgaccctagcgccaccattccatca
agagaagtccagcgttcgtcgcttatcgggaccagtccagctaaccccctcgatgttctt
gtcattggtggaggcgccacgggttcgggcgtggcactggatgccgtgacgcgtggactc
cgcgttggtctcgttgagagagaggatttctcttcgggaacttcctcccgctccactaag
ctcatacatggaggtgttcgatatttggagaaagccgtctttaaatttgattatggccaa
ctaaagttagtattccatgcactcgaggagcgtaaacaagttattgacaatgcaccccac
ctgtgcaatgctttgccttgcatgactccatgttttgactggtttgaagtagtgtactac
tggattggcttgaaaatgtatgacttgattgctggagcacgattattgcacttatcaaga
ttttactctacagaggagtctgttgagctctttcccactttggcaaaggagggaaaaggt
agaagactgagaggcactgttgtgtattacgatgggcaaatgaatgatgctagacttaat
gttggattggcttgcactgctgcattagctggtgcaacggtgctgaaccatgctgaagtt
gtatctttactgaaggatgatattggtgaacggataattggtgcgcaaataagggacact
ttgaccggcaaagaatttgatacatatgcaaaagtaattgtgaatgcggctggcccattt
tgcgactccataaggaaaatggctgacaaaaatgcaagagatatgatttgtccaagtagc
ggcgtacatatcatactccctgattattattctcccgagggaatgggcctaattgttcct
aaaacaaaggatggccgtgttgttttcatgctaccatggctaggacgaacagtagctggg
actacagattctaacaccgccattacttttctccctgaaccacatgaagatgaaatacaa
ttcatacttgatgctatatctgattaccttaatgttaaagtccggcgcactgatgttctc
tctgcttggagtggcattcgcccattagcaatggatccatcagcaaaaaatacagagagt
atctccagggatcatgttgtctgcgaggatctccctggtttgatcactatcactggtggc
aagtggaccacctatcgtagcatggcagaagatgctgtcgatgcagcaataaagtctggg
aagctgacccccaccagtggatgtgtgactcacaatctccatattgttggtggggaaggg
tgggatcctgcttcttttacagttcttactcaacaatatatgcgcatgaaaatatcatat
aagggtaaagttgttcctggggtaatggacactgcgtctgcaaagcatttgtctcacgca
tatggaacattggctgaacgagtggctgccattgctcaggatgaatgcttgggtaagcga
cttgctcatggttacccttttctggaggcagaggtggcatactgtgcacggcatgaatat
tgcgaatctgccattgatttcattgcaaggaggactcgtcttgctttcctcgacactgat
gcagcaggacgggcattgcctcgagtgattcaaatattagcagcagagcacaaatgggat
aagtcaagacagaagcaggagctgcagaaggctaaagaatttttggagacttttaaatcc
tccaaaaatgctcagttccatgacgggaaacataattag

DBGET integrated database retrieval system