KEGG   Arachis ipaensis: 107630060Help
Entry
107630060         CDS       T04301                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase, housekeeping isozyme
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aip  Arachis ipaensis
Pathway
aip00620  Pyruvate metabolism
aip00710  Carbon fixation in photosynthetic organisms
aip01100  Metabolic pathways
aip01200  Carbon metabolism
Module
aip_M00168  CAM (Crassulacean acid metabolism), dark
aip_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
aip_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
aip_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    107630060
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107630060
Enzymes [BR:aip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     107630060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 107630060
NCBI-ProteinID: XP_016188570
LinkDB All DBs
Position
B03
AA seq 966 aa AA seqDB search
MAKKLEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEVY
ELSAEYEGKHDSKKLDELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRIKL
KKGDFADENNATTESDIEETLKKLVVELKKSPQEVFEALKNQTVDLVLTAHPTQSVRRSL
LQKHGRIRNCLTQLYAKDVTPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMS
YFHETIWTGVPKFLRRLDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRD
VCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRADELNRSSRKDAVAKHYIEFWKII
PPNEPYRVLLGEVRDRLYQTRERSRHLLAHGHSEIPEEETFTNVEEFLEPLELCYRSLCA
CGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLEIGSYQEWSEEK
RQQWLLSELSGKRPLFGRDLPKTEEIKDVLDTFHVIAELPADNFGAYIISMATAPSDVLA
VELLQRECHVKHPLRVVPLFEKLADLEAAPAALARLFSIDWYRNRINGKQEVMIGYSDSG
KDAGRFSAAWQLYKAQEELIKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIH
GSLRVTVQGEVIEQSFGEQHLCFRTLQRYTAATLEHGMHPPISPKPEWRALMDQMAVIAT
EEYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPAKRKPSGGIETLRAIPWIFAWTQTR
FHLPVWLGFGEAFRHVIGKDIKNLHMLQEMYNQWPFFRVTLDLVEMVFAKGDPGIAALYD
KLLVSQDLWSFGEQLRTKFDETKKLLLQVCGHRDLLEGDPYLKQRLRLRDSYITTLNVCQ
AYTLKRIRDPNYNVNLRPHISKEYIEISKPADELITLNPTSEYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaagttggaaaagatggcatccattgatgcccaacttaggcagctggttccg
gcaaaagtgagcgaagatgacaaactgattgagtatgatgctctgctattggatcgcttc
cttgatattcttcaggacttacacggagaggatctgaaagaaacggttcaagaagtatac
gagctttctgctgaatatgaagggaaacacgactctaagaaactggacgaacttggaaat
ctgataactagtttggatgctggtgattcaattgtcgtcgccaaatccttttctcatatg
cttaacttggccaacttagcagaagaggtccagattgctcatcggcgaaggatcaagttg
aaaaagggagattttgctgatgagaacaatgcaactactgaatcagacattgaagaaaca
ctcaagaagcttgtagtggaattaaaaaagtctcctcaggaagtttttgaagcactgaaa
aaccagaccgttgatttggttcttacagctcaccctactcaatctgttcgtagatctttg
cttcagaagcatggaaggatacgaaactgtttaactcaattatatgccaaagatgtaact
cctgatgacaagcaggaacttgatgaggctctacagagggagatccaagctgccttccgt
actgatgaaattaggaggactcctccaaccccgcaagatgagatgagagcagggatgagc
tacttccatgagacaatttggactggtgtacccaaatttctacgtcggctggatacagct
ttgaagaatatagggataaatgaacgtgtcccttataatgctcctcttattcaattttct
tcttggatgggtggtgatcgtgatggcaatccaagagtaactcctgaagtgacaagggat
gtttgtttattggctagaatgatggctgctaatttatattattcccagatagaagatctt
atgtttgaactgtcaatgtggcgttgcaatgatgagctgcgtgtacgtgcagatgaactt
aacagatcttccaggaaagatgcagttgctaagcactatatagagttttggaaaatcatt
cccccaaatgaaccataccgtgtgttactgggcgaagtaagggataggctttatcagact
cgtgagcgatctcgccatttgctagcacacgggcactctgaaattccagaggaagaaact
tttaccaatgttgaggagttcttggaacccctggaactttgctatagatcactctgtgct
tgtggtgatcgggcaattgccgatggaagccttctagatttccttcggcaagtctctact
tttggattgtcactagtgaggcttgatatcaggcaagagtcagaccgtcatactgatgtg
ttggatgccattaccaagcatctggaaattggttcctaccaggaatggtcagaagagaaa
cggcagcaatggcttttgtctgaattgagtggcaaacggccactgtttgggcgcgacctt
cccaaaactgaagaaattaaagatgttttggacacatttcatgttattgctgaactgcca
gcagataactttggagcatatatcatatcaatggcaactgcaccatctgatgtgcttgca
gttgaacttctgcaacgtgaatgccatgtcaagcatccactaagagttgtcccattgttt
gagaaacttgcagatctggaggcagctcctgctgctttggctcggttgttctccatagac
tggtacagaaaccgaatcaacggaaagcaagaagttatgattggttattctgattcaggt
aaagatgctggaaggttctctgcagcatggcagctatataaggcccaagaggaacttatc
aaggtagctaaagagtatggtgttaagctaacaatgttccatggtcgcggtggaactgtt
gggagaggaggtggtccaacccaccttgctatcttatcccaacctccggatacaatccat
gggtcacttcgtgtaactgtccaaggtgaagttattgaacaatcatttggagagcagcac
ttatgtttccgaacacttcaacgttacactgctgcaactctagaacacggaatgcatcct
ccaatctcacccaaaccagagtggcgggctttgatggatcagatggctgtcattgctaca
gaggaataccgctctattgtattcaaagaacctcgatttgttgagtacttccgtctggct
acaccagagttggagtatggccgcatgaacataggaagtcgaccagcaaagcgaaagcca
agtggaggcattgagactctccgtgcaataccttggatatttgcctggacacaaacaagg
tttcatcttccggtgtggctaggcttcggggaagcatttagacatgttattgggaaggat
attaagaatcttcatatgctgcaagaaatgtacaatcagtggcctttcttcagggtcact
cttgatttagtggaaatggtgtttgccaagggagaccctggcatagctgccctgtatgat
aagctccttgtttcacaagatctatggtcgtttggggagcagttgaggaccaagtttgac
gaaaccaagaaactcctgcttcaggtgtgtggacacagagatcttcttgaaggggatcca
tacttaaaacaaaggctccgcttgcgtgattcttacattaccaccctgaacgtttgccaa
gcttacacattgaaacgtatccgtgatccgaactacaatgtgaatttgcgaccgcacatc
tcaaaagagtatatagagataagtaaacctgctgatgaacttataacactgaacccaaca
agtgaatatgctcctggtttggaagacaccctcatcctcaccatgaagggtattgctgct
ggcatgcagaacactggttaa

DBGET integrated database retrieval system