KEGG   Arachis ipaensis: 107630187Help
Entry
107630187         CDS       T04301                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
aip  Arachis ipaensis
Pathway
aip00010  Glycolysis / Gluconeogenesis
aip00051  Fructose and mannose metabolism
aip00052  Galactose metabolism
aip00500  Starch and sucrose metabolism
aip00520  Amino sugar and nucleotide sugar metabolism
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
aip01200  Carbon metabolism
Module
aip_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aip_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107630187
   00051 Fructose and mannose metabolism
    107630187
   00052 Galactose metabolism
    107630187
   00500 Starch and sucrose metabolism
    107630187
   00520 Amino sugar and nucleotide sugar metabolism
    107630187
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107630187
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aip04131]
    107630187
Enzymes [BR:aip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107630187
Membrane trafficking [BR:aip04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107630187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 107630187
NCBI-ProteinID: XP_016188747
LinkDB All DBs
Position
B03
AA seq 498 aa AA seqDB search
MGKIAAGATVVCTAALCAAAVLVVRHRMKSNGKWGRAVAILKEFGEKCETPDWKLRQVAD
AMDVEMHAGLASEGGSKLKMLISYVDNLPSGDEAGLFYALDLGGTNFRVLRVHLGGKEKG
VINQEFEEVSIPPHLMIGSSEGLFDFIASALAKFVNSEPEEFHPPPGRQRELGFTFSFPV
RQTSIASGTLIKWTKGFNIEDVVGEDVVGELTKSMQKIGLDMRVSALVNDTIGTLAGGRF
YNQDVIAAVILGTGTNAAYVERANAIPKWHGPLPKSGDMVINMEWGNFRSSHLPLTEYDV
ALDAESLNPGEQIFEKLISGMYLGDIVRRALLKMAEEADFFGDTVPPKLRVPFILRTPDM
SAMHHDTSPDLKVVGNKLKDILEISNTSLKMRKIVVELCDIVATRGARLSAAGILGILKK
TGRDTVKAGEKQKAVIALDGGLFEHYTKFRACLESTLNELLGEEAAKTIVIEHSNDGSGI
GAALLAASHSQYLGVDES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagattgcagcgggagctacagtcgtgtgcacggctgccctttgtgcggcggcg
gtgttggtagtgcgccaccggatgaagagcaacgggaagtggggtcgtgctgtggccata
ctgaaggagtttggggaaaagtgtgagaccccagattggaagctgaggcaggtggctgat
gccatggatgttgagatgcacgctggtctcgcatctgaaggtggcagcaagcttaagatg
ttgatcagctacgtcgataatctcccatctggggatgaggcagggctcttttatgctctg
gaccttggtggcacaaactttcgtgtccttcgtgtacatttaggtgggaaagagaaaggt
gtcatcaaccaagagtttgaagaagtttcaattcctcctcatttgatgattggttcttct
gaaggactgtttgattttatagcatctgctcttgcaaagtttgttaattcagaacctgaa
gaatttcatcctccccctggtagacaacgagaactgggctttacattctcattccctgtg
aggcaaacatcaattgcatctgggactctaataaagtggactaagggtttcaatattgaa
gatgtggttggggaagatgtcgtgggagaactaaccaagtcgatgcaaaaaattggcttg
gatatgcgagtttcagctctagttaatgataccattggaacactagctggaggcagattc
tacaatcaggatgtcattgctgctgtgatccttggtacagggacaaatgcagcatatgtg
gaacgtgcaaatgctattccaaaatggcatggccctctcccgaaatcaggagacatggtt
ataaacatggagtggggtaatttccgatcctcacatcttcctctaacagaatatgacgta
gctctagatgctgagagcttaaaccctggagagcagatatttgagaagttgatttctggt
atgtatttgggggacattgtaaggagagctttattgaagatggctgaagaagctgacttt
ttcggagatactgttccccccaagttgagagttcctttcatactcaggacccctgatatg
tcagcaatgcatcatgacacatctccagatctcaaagtagttggaaacaaattgaaagat
atattagagatctctaatacatccctcaaaatgaggaagattgttgtggagctctgcgac
attgttgccacacgtggggcacgtctttctgcggctggtattttgggcatcctgaagaaa
acaggaagagacaccgttaaggctggggagaagcaaaaggcagtgatagcactggatgga
ggattatttgaacactacactaagttcagagcttgcttggagagtacattgaatgagttg
ctcggagaagaggcggctaagactattgtgattgagcattctaacgacggctctggcatc
ggggctgctctccttgcagcatctcactcccagtatttgggagttgatgagtcttga

DBGET integrated database retrieval system